SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0G4QHU1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0G4QHU1
Domain Number 1 Region: 2-153
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.0000000196
Family SMI1/KNR4-like 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0G4QHU1
Sequence length 172
Comment (tr|A0A0G4QHU1|A0A0G4QHU1_PROVU) Uncharacterized protein {ECO:0000313|EMBL:CRL65204.1} KW=Complete proteome OX=585 OS=Proteus vulgaris. GN=BN1805_03234 OC=Morganellaceae; Proteus.
Sequence
MKNDQLINHLHSVYPELPINIHKIKGYSDDEIKKIERLYDIKVAGQLYDFLNCMGRCSGG
FFCDYSLLFYRYNFSVRGHVQFQIGTRNDLCNIKQFNLIKKKPFFISIESETQYLFLLTD
SDNPNQVYHYDENEEIVKETEWTLYQYLKKLINTETRKCVKKHCVTGELINI
Download sequence
Identical sequences A0A0G4QHU1
WP_072070579.1.56398

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]