SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0G4QHY3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0G4QHY3
Domain Number 1 Region: 5-72
Classification Level Classification E-value
Superfamily PAP/OAS1 substrate-binding domain 0.00000942
Family AadK C-terminal domain-like 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0G4QHY3
Sequence length 92
Comment (tr|A0A0G4QHY3|A0A0G4QHY3_PROVU) Uncharacterized protein {ECO:0000313|EMBL:CRL65229.1} KW=Complete proteome OX=585 OS=Proteus vulgaris. GN=BN1805_03246 OC=Morganellaceae; Proteus.
Sequence
MYGIREKNLKEWLPKFYSLRSLESTLAMSTPYESAASLSIMMAFFIDASKRLNHPLNTAT
KTQELVSNWLIDNEFLTENEYTQITSSIICHY
Download sequence
Identical sequences A0A0G4QHY3

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]