SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0G7GLY2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0G7GLY2
Domain Number 1 Region: 2-216
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 5.97e-77
Family Phosphate binding protein-like 0.00000224
Further Details:      
 
Domain Number 2 Region: 219-306
Classification Level Classification E-value
Superfamily Porphobilinogen deaminase (hydroxymethylbilane synthase), C-terminal domain 4.32e-21
Family Porphobilinogen deaminase (hydroxymethylbilane synthase), C-terminal domain 0.00096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0G7GLY2
Sequence length 308
Comment (tr|A0A0G7GLY2|A0A0G7GLY2_9STRE) Pre-uroporphyrinogen synthase {ECO:0000256|HAMAP-Rule:MF_00260} KW=Complete proteome OX=148942 OS=Streptococcus equi subsp. equi. GN=ERS044360_00173 OC=Streptococcus.
Sequence
MRKLVVGSRRSKLALTQSRQFIDKLKAIDPSLEIEIKEIVTKGDLIVDKQLSKVGGKGLF
VKEIQNELFNHGIDMAIHSLKDVPSVIPDGLTLGCIPDRENPYDAYIAKNHVPLNELPDN
SIVGTSSLRRGAQILAKYPKLQIKWIRGNIDTRLNKLETEDYDAIILAAAGLKRMGWSDD
IVTSYLDKETLIPAIGQGALGIECRSDDETLLSLLSKVHNQDVADCVTAERTFLTRMNGS
CQVPIGGYATKEADGTIEFTGLIMSPDGKERYQHTVRGTDPVALGEEVTKVLNEQGAYEI
IKALNEEQ
Download sequence
Identical sequences A0A0G7GLY2 A0A2K3Y9N6 Q49YA2
WP_011302930.1.18345 WP_011302930.1.18592 WP_011302930.1.25302 WP_011302930.1.26712 WP_011302930.1.27163 WP_011302930.1.28029 WP_011302930.1.28454 WP_011302930.1.31168 WP_011302930.1.37492 WP_011302930.1.37647 WP_011302930.1.43091 WP_011302930.1.43215 WP_011302930.1.45004 WP_011302930.1.59350 WP_011302930.1.66168 WP_011302930.1.68345 WP_011302930.1.68604 WP_011302930.1.74507 WP_011302930.1.74667 WP_011302930.1.76174 WP_011302930.1.77974 WP_011302930.1.8052 WP_011302930.1.81985 WP_011302930.1.82244 WP_011302930.1.84863 WP_011302930.1.9070 WP_011302930.1.91454 WP_011302930.1.94572 342451.SSP1094 gi|73662403|ref|YP_301184.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]