SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0G8CHP2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0G8CHP2
Domain Number 1 Region: 9-124
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.000000163
Family SMI1/KNR4-like 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0G8CHP2
Sequence length 134
Comment (tr|A0A0G8CHP2|A0A0G8CHP2_BACCE) Uncharacterized protein {ECO:0000313|EMBL:KKZ99275.1} KW=Complete proteome OX=1396 OS=Bacillus cereus. GN=B4147_3859 OC=Bacillus cereus group.
Sequence
MYTVDTKEPPSKEKEIKALQHFSVIDVPTEYIEMIQLASNVEINVNDQMYIRIWGASDCI
EMNEAYKVQNYLLHSPAIGDDEGGGVLIYLQGKEGFGIYYNSFGNLDMEDAVKIAPSLTE
LLVNNVGVNILLDI
Download sequence
Identical sequences A0A0G8CHP2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]