SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0G8CJR8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0G8CJR8
Domain Number 1 Region: 1-146
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 3.14e-20
Family SMI1/KNR4-like 0.008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0G8CJR8
Sequence length 151
Comment (tr|A0A0G8CJR8|A0A0G8CJR8_BACCE) Uncharacterized protein {ECO:0000313|EMBL:KKZ99286.1} KW=Complete proteome OX=1396 OS=Bacillus cereus. GN=B4147_3870 OC=Bacillus cereus group.
Sequence
MWREKISHISKIREKRNRKLNLPINEKELSKFRKSVVEKFGEDVLPQQYYEFLQTVNGIE
FNGLIIYGIDQSFLDFKPINQVDSFFDANEIWESIKDEDELIFFGDSDIAWYCYNVSKKK
FVELDKPSGEHMETFCDFDTMLKSALSAALS
Download sequence
Identical sequences A0A0G8CJR8 A0A2A8WID6 A0A2C4ZJA4
WP_000267973.1.23427 WP_000267973.1.30788 WP_000267973.1.37027 WP_000267973.1.72554 WP_000267973.1.76342 WP_000267973.1.78264 WP_000267973.1.89704

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]