SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0G8DSW2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A0G8DSW2
Domain Number - Region: 78-143
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.0337
Family SMI1/KNR4-like 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0G8DSW2
Sequence length 149
Comment (tr|A0A0G8DSW2|A0A0G8DSW2_BACCE) Uncharacterized protein {ECO:0000313|EMBL:KXX98410.1} KW=Complete proteome OX=1396 OS=Bacillus cereus. GN=AT274_00140 OC=Bacillus cereus group.
Sequence
MRLEYRLNDETKKYPALWNYTNISNAEIIARMTCEYFIKDKNTYVVTATSVDPDGTAVIY
IQKEEFANDPSDPIYSHIGFEVRELSETSSSIINSKDVWNYEEILPSLHSDIIYIQHDGM
HMEFTLDSREIDEDRKCYIYYGNFTGESR
Download sequence
Identical sequences A0A0G8DSW2 A0A0J1HPY9 A0A0K6MHG0 A0A154AZS4 A0A1S9AP82 A0A243BK06 A0A243CTG3 B7JHU3 C2TEF5 D8H7T3 Q81SP6
gi|227815576|ref|YP_002815585.1| gi|229603719|ref|YP_002866079.1| gi|47526875|ref|YP_018224.1| gi|30261672|ref|NP_844049.1| gi|386735380|ref|YP_006208561.1| gi|218902787|ref|YP_002450621.1| gi|49184501|ref|YP_027753.1| NP_844049.1.87267 WP_001235537.1.100214 WP_001235537.1.100409 WP_001235537.1.100595 WP_001235537.1.101931 WP_001235537.1.10208 WP_001235537.1.11387 WP_001235537.1.11427 WP_001235537.1.11676 WP_001235537.1.12289 WP_001235537.1.13115 WP_001235537.1.13233 WP_001235537.1.13820 WP_001235537.1.14721 WP_001235537.1.14855 WP_001235537.1.14882 WP_001235537.1.15460 WP_001235537.1.15569 WP_001235537.1.16013 WP_001235537.1.16170 WP_001235537.1.16997 WP_001235537.1.17146 WP_001235537.1.17424 WP_001235537.1.18976 WP_001235537.1.19258 WP_001235537.1.19435 WP_001235537.1.19445 WP_001235537.1.20390 WP_001235537.1.20680 WP_001235537.1.21021 WP_001235537.1.21258 WP_001235537.1.21776 WP_001235537.1.22865 WP_001235537.1.23269 WP_001235537.1.2419 WP_001235537.1.24334 WP_001235537.1.24556 WP_001235537.1.24608 WP_001235537.1.25716 WP_001235537.1.25752 WP_001235537.1.2618 WP_001235537.1.26665 WP_001235537.1.26721 WP_001235537.1.27644 WP_001235537.1.27987 WP_001235537.1.28427 WP_001235537.1.28729 WP_001235537.1.29101 WP_001235537.1.29787 WP_001235537.1.29804 WP_001235537.1.30110 WP_001235537.1.31490 WP_001235537.1.3236 WP_001235537.1.32576 WP_001235537.1.33175 WP_001235537.1.33338 WP_001235537.1.33367 WP_001235537.1.33740 WP_001235537.1.33876 WP_001235537.1.34646 WP_001235537.1.35684 WP_001235537.1.35886 WP_001235537.1.36305 WP_001235537.1.36763 WP_001235537.1.38036 WP_001235537.1.39781 WP_001235537.1.40550 WP_001235537.1.41165 WP_001235537.1.41675 WP_001235537.1.4439 WP_001235537.1.45305 WP_001235537.1.45533 WP_001235537.1.45919 WP_001235537.1.46236 WP_001235537.1.46699 WP_001235537.1.47145 WP_001235537.1.4763 WP_001235537.1.47644 WP_001235537.1.47798 WP_001235537.1.51749 WP_001235537.1.52794 WP_001235537.1.53137 WP_001235537.1.53493 WP_001235537.1.53683 WP_001235537.1.54117 WP_001235537.1.54189 WP_001235537.1.55811 WP_001235537.1.55958 WP_001235537.1.56042 WP_001235537.1.56176 WP_001235537.1.56270 WP_001235537.1.56959 WP_001235537.1.58160 WP_001235537.1.59095 WP_001235537.1.59310 WP_001235537.1.59575 WP_001235537.1.60402 WP_001235537.1.61213 WP_001235537.1.63137 WP_001235537.1.63560 WP_001235537.1.63611 WP_001235537.1.66357 WP_001235537.1.68607 WP_001235537.1.69203 WP_001235537.1.69822 WP_001235537.1.69894 WP_001235537.1.70065 WP_001235537.1.70996 WP_001235537.1.71895 WP_001235537.1.72704 WP_001235537.1.73325 WP_001235537.1.74226 WP_001235537.1.74337 WP_001235537.1.74538 WP_001235537.1.7545 WP_001235537.1.75499 WP_001235537.1.75870 WP_001235537.1.76125 WP_001235537.1.76783 WP_001235537.1.77668 WP_001235537.1.77824 WP_001235537.1.7856 WP_001235537.1.78644 WP_001235537.1.79315 WP_001235537.1.79584 WP_001235537.1.80439 WP_001235537.1.80695 WP_001235537.1.81799 WP_001235537.1.82289 WP_001235537.1.83951 WP_001235537.1.84045 WP_001235537.1.85689 WP_001235537.1.86119 WP_001235537.1.86140 WP_001235537.1.86239 WP_001235537.1.86288 WP_001235537.1.8698 WP_001235537.1.8825 WP_001235537.1.88641 WP_001235537.1.90791 WP_001235537.1.90883 WP_001235537.1.9186 WP_001235537.1.92686 WP_001235537.1.92831 WP_001235537.1.93271 WP_001235537.1.93744 WP_001235537.1.93927 WP_001235537.1.94237 WP_001235537.1.94322 WP_001235537.1.94784 WP_001235537.1.95308 WP_001235537.1.96934 WP_001235537.1.97781 WP_001235537.1.97861 WP_001235537.1.98216 WP_001235537.1.99445 WP_001235537.1.99485 WP_001235537.1.99994 YP_027753.1.16718 gi|301053211|ref|YP_003791422.1| 198094.BA_1600 260799.BAS1484 261594.GBAA1600 405535.BCAH820_1670 568206.BAMEG_2991 592021.BAA_1671

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]