SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0G8F3Q1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0G8F3Q1
Domain Number 1 Region: 137-277
Classification Level Classification E-value
Superfamily PAP/OAS1 substrate-binding domain 1.49e-54
Family AadK C-terminal domain-like 0.0000191
Further Details:      
 
Domain Number 2 Region: 1-131
Classification Level Classification E-value
Superfamily Nucleotidyltransferase 2.13e-48
Family AadK N-terminal domain-like 0.0000132
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0G8F3Q1
Sequence length 278
Comment (tr|A0A0G8F3Q1|A0A0G8F3Q1_BACCE) Uncharacterized protein {ECO:0000313|EMBL:KLA31171.1} KW=Complete proteome OX=1396 OS=Bacillus cereus. GN=B4077_3439 OC=Bacillus cereus group.
Sequence
MRTEKEMMELILRVALEDDRVRAVGMNGSRANANVPKDNFRDYDIVYLVSDFQSFLNTPD
WVDVFGKRIIMQTPEDMELIPPELDGRFTYLMLFEDGNRIDLMLIPIEEKNEYCSEDGLT
IILLDKDKKMPILDEPTDEGYWVKKPSAVFFADCCNEFWWISTNVAKGLWREEILYAYEH
LNSVREMLLTMLEWKVGIETNFSLSVGKNSKYLERYVNKEIWESLLKTYPNGEYKQVWNS
LFEMICLFEQVAIEVADILEYQYPYEEANKVKDYLNKK
Download sequence
Identical sequences A0A0G8F3Q1
WP_046954505.1.4039

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]