SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0G8G3F6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0G8G3F6
Domain Number 1 Region: 186-230
Classification Level Classification E-value
Superfamily R3H domain 0.00000000334
Family R3H domain 0.0083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0G8G3F6
Sequence length 236
Comment (tr|A0A0G8G3F6|A0A0G8G3F6_9LACO) RNA-binding protein {ECO:0000313|EMBL:KLA43371.1} KW=Complete proteome OX=1623 OS=Lactobacillus ruminis. GN=LRP_1430 OC=Lactobacillus.
Sequence
MKFSAQTAEQAIEKGLQELGKTREEVEIVIISEGKKGFLGIFGGNPAEVEIMPKETERVE
EKDETVAEPEPSDEKEEAESEQEVEQALREVGSYLAEVTKEMGVETKIEVTVERRDVFYN
FSADQEGILIGKHGKTLNSLQLLAQNYFDKLSFKRLNIILDVADYRERRTETLKYLAKKV
AYDAISQRRRMQLDPMPAYERKVIHSALADNSKVKTYSRGAEPRRYVVIEPARSRG
Download sequence
Identical sequences A0A0G8G3F6
WP_046921840.1.39798

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]