SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0G9HGQ0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0G9HGQ0
Domain Number 1 Region: 2-86
Classification Level Classification E-value
Superfamily Obg GTP-binding protein N-terminal domain 1.31e-31
Family Obg GTP-binding protein N-terminal domain 0.0000811
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0G9HGQ0
Sequence length 87
Comment (tr|A0A0G9HGQ0|A0A0G9HGQ0_9XANT) GTPase CgtA {ECO:0000313|EMBL:KLD68975.1} KW=Complete proteome OX=1440765 OS=Xanthomonas hyacinthi DSM 19077. GN=Y886_43865 OC=Xanthomonadaceae; Xanthomonas.
Sequence
TGGNGCVSFRREKFIPFGGPDGGDGGNGGSVWLVADEGLNTLVDFRHMRAFKAERGQGGM
GSQMYGKGGEDSEVRVPVGTIVINVDT
Download sequence
Identical sequences A0A0G9HGQ0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]