SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0H0SGW6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0H0SGW6
Domain Number 1 Region: 2-133
Classification Level Classification E-value
Superfamily Hypothetical protein YwqG 2.88e-25
Family Hypothetical protein YwqG 0.00018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0H0SGW6
Sequence length 135
Comment (tr|A0A0H0SGW6|A0A0H0SGW6_9BACL) Uncharacterized protein {ECO:0000313|EMBL:KLH97620.1} KW=Complete proteome OX=54913 OS=Brevibacillus formosus. GN=AA984_17200 OC=Brevibacillus.
Sequence
MEHIQKSAKSSIKLTLTKEAATLTDSKVGGKPWLPPEMPYPQDEDGNNYLFLAQINWAQM
PRLDGYPASGLTSFFVKEDDTFGLMDQSFQVLHFEEFIDTQELDPFQPEDLDVYSPVLGG
PYKLTGKRESQYVPH
Download sequence
Identical sequences A0A0H0SGW6
WP_047071347.1.16100

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]