SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0H0YTB4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0H0YTB4
Domain Number 1 Region: 70-121
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.0000000249
Family SMI1/KNR4-like 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0H0YTB4
Sequence length 213
Comment (tr|A0A0H0YTB4|A0A0H0YTB4_LACCA) Uncharacterized protein {ECO:0000313|EMBL:KLI75835.1} KW=Complete proteome OX=1582 OS=Lactobacillus casei. GN=AAW28_10130 OC=Lactobacillus.
Sequence
MLPWPNKIPQPNLPTIPHTDLIPSTYFSTIKTGCLPKRWWLPTSEPTSDGLDGVGIHAFA
TPGAAITADDLPADLLPFAHTGHQYFGFDLSHDPRRIRYIDTEVDQWLTVAPDFDTFLKQ
LQPHPVRLPELPVEPQVFGHMAVIATADDWLALFDHARTFMTGAEIGPWLIWLATSADSA
KRQAAAEEYHFLSRYQPNFLTPNTTIELRKLLS
Download sequence
Identical sequences A0A0H0YTB4
WP_047107143.1.19623

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]