SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0H1AV36 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0H1AV36
Domain Number 1 Region: 153-298
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 5.49e-16
Family SMI1/KNR4-like 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0H1AV36
Sequence length 325
Comment (tr|A0A0H1AV36|A0A0H1AV36_9ACTN) Cell wall assembly protein Knr4 {ECO:0000313|EMBL:KLJ00856.1} KW=Complete proteome OX=1638939 OS=Streptomyces sp. KE1. GN=WQ59_14385 OC=Streptomyces.
Sequence
MTTGRLGQQAAPPNAAYAGQVVHFPDPVRAKRHPAGVRVDGDGYPDFTPYARAAVEIADP
PEGFGVDELRLTDYVSANAALAAAGHELWETLPAVATPHGWTWHHVARTRRLQLVPVEVK
ALLRHHAGLATTAVDHGKRGTRPLQETRPAHFALPKGATAVSEQQVLAAEEDLGYRLPGA
YRDFLKAAGGCAPAGVALDAELGLLVDQPFLTLRDQAAANDLVYANKCLRDHLTKDYLGV
AFVQGGLLAVKVRGERTGSVWFCAYDDARDQDGWSVQDRVERLLLPCGDDFDAFLDRLAG
SPPELETVANLMVDGGFAEAVPVEG
Download sequence
Identical sequences A0A0H1AV36 A0A0S1UKH5 A0A0X3X7N9 A0A126Y1G8 A0A1C4NE66 A0A1C4S6T2 A0A209CBT7
gi|478688625|ref|YP_007745435.1| WP_010643041.1.17225 WP_010643041.1.19862 WP_010643041.1.23992 WP_010643041.1.25010 WP_010643041.1.29512 WP_010643041.1.31976 WP_010643041.1.3281 WP_010643041.1.40734 WP_010643041.1.43113 WP_010643041.1.50088 WP_010643041.1.52204 WP_010643041.1.52668 WP_010643041.1.62881 WP_010643041.1.69503 WP_010643041.1.71906 WP_010643041.1.73990 WP_010643041.1.77676 WP_010643041.1.90031

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]