SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0H1BGX1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0H1BGX1
Domain Number 1 Region: 99-233
Classification Level Classification E-value
Superfamily Homo-oligomeric flavin-containing Cys decarboxylases, HFCD 5.76e-17
Family Homo-oligomeric flavin-containing Cys decarboxylases, HFCD 0.00045
Further Details:      
 
Domain Number 2 Region: 402-413,467-577
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.00000115
Family Pseudo ankyrin repeat 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0H1BGX1
Sequence length 662
Comment (tr|A0A0H1BGX1|A0A0H1BGX1_9EURO) Uncharacterized protein {ECO:0000313|EMBL:KLJ10595.1} KW=Complete proteome; Reference proteome OX=1246674 OS=Emmonsia parva UAMH 139. GN=EMPG_14045 OC=Eurotiomycetidae; Onygenales; Ajellomycetaceae; Emmonsia.
Sequence
MAVDFTPPHTLSPQDSKVQGPHDKVTAMPGVALASRATGMEIGGHSHVYGNKNGTVVGEH
EVELDRNNWMSASNLSCNKNLRQNVLISTNTSFAEIAIPFLKKISDVEIRVISEDVLDFA
QGTCYLNAPISAQPGSKLSSRPWLDSTAAELVDWADVLILNPIDAGTLGAMIAGLTTSLT
LTVLRAWDITKTVLLVPGMTTSEWQSPITKRQLRDLATFWPWVKVLPPTLSKFELPAGLV
EIPWDGWSAFSCEIGKCLAPSFLPSTMQNDDKLANDVASGIISTPLAISNNQHEKREQVT
NKETYQNGINKDLNNAIRKEKPILPPELLTMIFEMLDDWETATSVGVYAKIPVPEKWKPY
IPSPGSPATFEYIVLRGSIKEIEQQLSTIPPRKPLSRIVTDLILKFSRTDILDTLCKSRM
DLYLSTPQLKNLPLSASSRFGSTSILTWWQNCSTLPSLPIKDYLPEAIDAASRAGFVNVL
EWWRQSGRPFRYTERSLESASAEGQIAILDWWKNISKSAPPGDPVPLKVGKSVLLAAQSG
RTDSLAWWDKSDIPFSHAESVTRIASNHGHVPVLDFWHRRKREKLIFDNQVLVGATKNGH
VEVLEWWKRSGLPVEFKTCDIEEALEDAVSGVEQRVRRWWARNGLNLGVGTNEWMMVKTL
NS
Download sequence
Identical sequences A0A0H1BGX1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]