SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0H1BN83 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0H1BN83
Domain Number 1 Region: 4-63
Classification Level Classification E-value
Superfamily AN1-like Zinc finger 0.00000000000000105
Family AN1-like Zinc finger 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0H1BN83
Sequence length 73
Comment (tr|A0A0H1BN83|A0A0H1BN83_9EURO) Uncharacterized protein {ECO:0000313|EMBL:KLJ12583.1} KW=Complete proteome; Reference proteome OX=1246674 OS=Emmonsia parva UAMH 139. GN=EMPG_12411 OC=Eurotiomycetidae; Onygenales; Ajellomycetaceae; Emmonsia.
Sequence
MAPPRKPRCNFKACKELAQRIVGDCGFCNGHFCGKHRMLESHACSGLEDCKKESHERNAE
RLNAERTTVIKGV
Download sequence
Identical sequences A0A0H1BN83

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]