SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0H1RWC8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0H1RWC8
Domain Number 1 Region: 278-448
Classification Level Classification E-value
Superfamily MgtE membrane domain-like 7.59e-53
Family MgtE membrane domain-like 0.0000235
Further Details:      
 
Domain Number 2 Region: 135-266
Classification Level Classification E-value
Superfamily CBS-domain pair 7.33e-31
Family CBS-domain pair 0.0000367
Further Details:      
 
Domain Number 3 Region: 8-132
Classification Level Classification E-value
Superfamily MgtE N-terminal domain-like 1.44e-26
Family MgtE N-terminal domain-like 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0H1RWC8
Sequence length 452
Comment (tr|A0A0H1RWC8|A0A0H1RWC8_BACPU) Magnesium transporter MgtE {ECO:0000256|RuleBase:RU362011} KW=Complete proteome OX=1408 OS=Bacillus pumilus (Bacillus mesentericus). GN=B4107_1205 OC=Bacteria; Firmicutes; Bacilli; Bacillales; Bacillaceae; Bacillus.
Sequence
MIQNITYDELILRIIILLRDGKRKEFKNIMEELQPYDMAYLFKELPEKHRGRFLSFLTVD
DVTEMMGELEREYQEIVLEKVGKDKATFVTNKMDNDDLANLFDEMDDELKDQLLSNMEAE
ESKAVQLLMNYPAETAGRIMTNRYVWIPQHYTVQDAVVKLKSFAEIAESINYLYVINDQK
QLVGVLSYRDLILGEPDEKVQDLMFTRVIAVGAFQDQEEIAKLIERYDFLAIPVVEENNV
LVGIVTVDDIIDVVIQEAGEDYEKFAASGKDITFDTPAFVAAYRRLPWLILLLFIGLISG
SILNYFEDTLQQVVALAFFMPMIAGMTGNTGTQSLAVVIRGLSKEELTKKTIMRLIFREL
RTSIYIGIVCSIIITVVAMVWQGNMILGFVVGSSLLATLIIGTMAGTIVPIILHRLNVDP
AIASGPLITTLNDILSLLIYFGIATAFLHTLM
Download sequence
Identical sequences A0A0B4S6L3 A0A0H1RWC8 A0A1L7A6K8 A0A1V1Z3V0
WP_039178033.1.19850 WP_039178033.1.23142 WP_039178033.1.23298 WP_039178033.1.33560 WP_039178033.1.35170 WP_039178033.1.44172 WP_039178033.1.52937 WP_039178033.1.60715 WP_039178033.1.65727 WP_039178033.1.72846

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]