SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0H1RZ75 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0H1RZ75
Domain Number 1 Region: 9-124
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 6.8e-21
Family SMI1/KNR4-like 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0H1RZ75
Sequence length 131
Comment (tr|A0A0H1RZ75|A0A0H1RZ75_BACPU) Uncharacterized protein {ECO:0000313|EMBL:KLL00355.1} KW=Complete proteome OX=1408 OS=Bacillus pumilus (Bacillus mesentericus). GN=XJ18_06625 OC=Bacteria; Firmicutes; Bacilli; Bacillales; Bacillaceae; Bacillus.
Sequence
MLNLTQILNLHVNKPASDIHIKEAESQLNMVLPHAYKELLKQTNGCSVGGDVLLYGTEDI
VERNATWEVQQYANGYAAIGDDGGGRVLLMRQAEEEKKVWIVDTGVMDPQHAELVAEDLL
SWVNEGCFIEV
Download sequence
Identical sequences A0A0H1RZ75
WP_047202592.1.23142

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]