SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0H1U114 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0H1U114
Domain Number 1 Region: 137-279
Classification Level Classification E-value
Superfamily PAP/OAS1 substrate-binding domain 5.34e-49
Family AadK C-terminal domain-like 0.000054
Further Details:      
 
Domain Number 2 Region: 1-134
Classification Level Classification E-value
Superfamily Nucleotidyltransferase 7.52e-43
Family AadK N-terminal domain-like 0.0000973
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0H1U114
Sequence length 287
Comment (tr|A0A0H1U114|A0A0H1U114_STRAG) Aminoglycoside adenylyltransferase {ECO:0000313|EMBL:KLL25072.1} KW=Complete proteome OX=1311 OS=Streptococcus agalactiae. GN=WA34_11190 OC=Streptococcus.
Sequence
MRTEEEMFQLIMDVAKQEEHIRAVGMVGSRTNVKAPKDSFQDFDIVYIVEPCAEFFETAT
WIAKFGQPLIMQRPKEMTLFPTEPKTRETFLMLFEDGQRIDLTLCPLAEKDNWHEGDSLA
IILLDKDENLPPLPVASDKNYTVTVPNQQQFNDCCNEFWWVSTYVVKGLCRNELFYAVTH
LYEYCQQELLRLLSWQAAWQEPEPISVGKQFKYLKNYVTPDTMDQLASLLDFSSKEACWN
SLIKTQAFFDVIAQDFAKMAQFTYHLQEAKKVTEYTNSLRLKDLQGK
Download sequence
Identical sequences A0A0H1U114 A0A0M2AQN1 E0H961
WP_002406050.1.30275 WP_002406050.1.31224 WP_002406050.1.37031 WP_002406050.1.42239 WP_002406050.1.45742 WP_002406050.1.61103 WP_002406050.1.6167 WP_002406050.1.62644 WP_002406050.1.63579 WP_002406050.1.66767 WP_002406050.1.7118 WP_002406050.1.78587 WP_002406050.1.83649 WP_002406050.1.85848 WP_002406050.1.94612 WP_002406050.1.99014

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]