SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0H2KS31 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0H2KS31
Domain Number 1 Region: 91-234
Classification Level Classification E-value
Superfamily Sortase 9.94e-30
Family Sortase 0.0091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0H2KS31
Sequence length 259
Comment (tr|A0A0H2KS31|A0A0H2KS31_9MICO) Uncharacterized protein {ECO:0000313|EMBL:KLN36351.1} KW=Complete proteome; Reference proteome OX=264251 OS=Cellulosimicrobium funkei. GN=FB00_00425 OC=Cellulosimicrobium.
Sequence
MTATAPAPVRHAGRRSSGRGAVSTVVGVVGELLITLGILLGLYVVWQLWWTDVQADRVQA
QVLEEMDAPTPDAADVATAVRRDEPPVMEAPALGEVWGTLYVPRWDGKMMPIAEGTDKRS
ILDQGQAGHYPETVMPGAVGNFSLAGHRQTYGKIFHDVEELEIGDPIVVEAGGVWYVYRV
DHMQAVKPDQVEAVAPVPWQPGVEPTERYLTLTTCHPIGLNSLVARFIVNAKLDYWMPVE
DGTPPDLVGQAAPAAEGSA
Download sequence
Identical sequences A0A0H2KS31 A0A0M0F6Y2
WP_064316701.1.33156 WP_064316701.1.80574 WP_064316701.1.93545

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]