SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0H2QUW1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0H2QUW1
Domain Number 1 Region: 1-136
Classification Level Classification E-value
Superfamily Nucleotidyltransferase 1.96e-30
Family AadK N-terminal domain-like 0.0029
Further Details:      
 
Domain Number 2 Region: 143-279
Classification Level Classification E-value
Superfamily PAP/OAS1 substrate-binding domain 1.26e-29
Family AadK C-terminal domain-like 0.0086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0H2QUW1
Sequence length 287
Comment (tr|A0A0H2QUW1|A0A0H2QUW1_9GAMM) Uncharacterized protein {ECO:0000313|EMBL:KLN97140.1} KW=Complete proteome OX=158849 OS=Moellerella wisconsensis. GN=VK86_06190 OC=Morganellaceae; Moellerella.
Sequence
MESTAQLLNRIISFALLDPRIEAVIMTGSRARVTGVDNYSDLDIEFVGQGVNDFTQSTQW
LNQFGNPLITLQLANEKPNEPDWPTCLVIFEQGRKIDFTFAEPIRLTAMKHAGLDAIYAR
GYGVLLDKSGVTNGLPEYIPEQHPRILLPSPEQFNALVTDFWFEAHQVAILLTRDERWLA
WQRDHSMKNGLLTMLEWLVTIDNPNQDCWYQGKSFNQWMPKRYLACMDKIFNFNNANTAA
GGLILLLDTFTEASEEVANALNYPDYSSVSQKITELANDILLDNQLI
Download sequence
Identical sequences A0A0H2QUW1
WP_047255723.1.93926

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]