SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0H2SH05 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0H2SH05
Domain Number 1 Region: 416-460,488-537,566-599
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 1.07e-29
Family Regulator of G-protein signaling, RGS 0.00085
Further Details:      
 
Domain Number 2 Region: 212-339
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.0000000000000505
Family DEP domain 0.026
Further Details:      
 
Domain Number 3 Region: 37-140
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.0000296
Family MukF N-terminal domain-like 0.072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0H2SH05
Sequence length 654
Comment (tr|A0A0H2SH05|A0A0H2SH05_9HOMO) Uncharacterized protein {ECO:0000313|EMBL:KLO16381.1} KW=Complete proteome; Reference proteome OX=27342 OS=Schizopora paradoxa. GN=SCHPADRAFT_823329 OC=Agaricomycetes; Hymenochaetales; Schizoporaceae; Schizopora.
Sequence
MPEQPGQLQQPQATTSHMMKTTKRGRPFLKDTLDLFATLIVSLELSTHKQFFKSFPNSFT
TDEAAANLAALKFSQSNRGPDPRDPSRIVTTTTTTTFSMTRDMAKAMCQHFMDARLIENA
ADRNSNLFKERGVFVLTPKGLHVLERFISKNGISAEPLAKVFSSQPICLKLLHLERRSTD
DEIIISQAVVTALFRRFAGRAANYMPDTAPLDQSQEYHERSKGIPLVDVTERAAGLIGRS
ANTAFKYCFQAVTALEWLCDFTSIVGRDEAAEMAAHFVRFGLISLVSDKRKGNDSAIIFT
VRGSAPTGGNSPVSQQGEFRCTSKAIYRITDEGRRVARWDVPQARAPNGHDSPNASSTNV
AKERSSLERDASTADHTYPSTKGETSTTVGTDPKLVRRVSLSERRDEDPGESRRRGQKES
NADRLRFILNEPAVRNLFRDFLKTNFCEENLTFWLEVEDFKRKFNTTSSARGGADSYRAP
VKGTPGQAAMEKHHDALIQIAFIIYNTYLAPSSQCELNIDHGLRGELVSYLNQVMTEVTG
KAFQGRVEPEQAAALNATQLQTMIRLYDRIQIHVFRLMATDSVPKFIKTPEFKALKAWVD
DDGSTDDDSIDPAASTPVLPPGLVENPEQGRVHVTKSQAGNEHAHRPERPGKSA
Download sequence
Identical sequences A0A0H2SH05

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]