SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0H2UT31 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A0H2UT31
Domain Number - Region: 60-146
Classification Level Classification E-value
Superfamily TolA/TonB C-terminal domain 0.00667
Family TolA 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0H2UT31
Sequence length 183
Comment (tr|A0A0H2UT31|A0A0H2UT31_STRP3) Uncharacterized protein {ECO:0000313|EMBL:AAM78709.1} KW=Complete proteome OX=198466 OS=Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315). GN=SpyM3_0102 OC=Streptococcus.
Sequence
MILTMLAFNQTVLAKDSTVQTSISVENVLERAGDSTPFSIALESIDAMKTIEEITIAGSG
KASFSPLTFTTVGQYTYRVYQKPSQNKDYQADTTVFDVLVYVTYDEDGTLVAKVISRRAG
DEEKSAITFKPKWLVKPIPPRQPNIPKTPLPLAGEVKSLLGILSIVLLGLLVLLYVKKLK
SRL
Download sequence
Identical sequences A0A0H2UT31 B8QYJ4
198466.SpyM3_0102 gi|21909638|ref|NP_663906.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]