SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0H2V065 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A0H2V065
Domain Number - Region: 104-176
Classification Level Classification E-value
Superfamily lambda integrase-like, N-terminal domain 0.0251
Family lambda integrase-like, N-terminal domain 0.0099
Further Details:      
 
Domain Number - Region: 60-125
Classification Level Classification E-value
Superfamily BAH domain 0.034
Family BAH domain 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0H2V065
Sequence length 195
Comment (tr|A0A0H2V065|A0A0H2V065_SHIFL) Putative regulator of FliA {ECO:0000313|EMBL:AAN43515.1} KW=Complete proteome OX=623 OS=Shigella flexneri. GN=S2060 OC=Enterobacteriaceae; Shigella.
Sequence
MPHFNFDYQEFLMMVQHLKRRPLSRYLKDFKHSQTHCAHCRKLLDRITLVRDGKIVNKIE
ISRLDTLLDEKGWQTEQQSWAALCRFCGDLHCKTQSDFFDIIGFKKFLFEQTEMSPGTVR
EYVVRLRRLGNHLHEQNISLDQLQDGFLDEILAPWLPTTSTNNYRIALRKYQHYQRQTCT
GLVQKSSSLPASDIY
Download sequence
Identical sequences A0A0H2V065 A0A226KBK9 D2AIA8
gi|384543577|ref|YP_005727640.1| NP_707808.1.23235 gi|30063364|ref|NP_837535.1| gi|24113298|ref|NP_707808.1| 198214.SF1964 198215.S2060 APC27700

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]