SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0H2W6S2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0H2W6S2
Domain Number 1 Region: 49-148
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.000000373
Family SMI1/KNR4-like 0.0083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0H2W6S2
Sequence length 156
Comment (tr|A0A0H2W6S2|A0A0H2W6S2_YERPE) Uncharacterized protein {ECO:0000313|EMBL:AAS63133.2} KW=Complete proteome OX=632 OS=Yersinia pestis. GN=YP_2953 OC=Yersiniaceae; Yersinia.
Sequence
MTDIEKAVTTFQAYRAAIGYPKIPPYEGEVIEYDFGRKIESNQPDFWTQYHEFLRLSDGL
AADGVYFYGIACEGKLIGNRLIDNNDALRDGEMYDESMDGLIAIGSSNSDIFVYDTNTHK
WESRDRIAIDDINESYDTLAELIDSQLQRINIGDAF
Download sequence
Identical sequences A0A0E1NRY7 A0A0E8XJT6 A0A0H2W6S2 A0A0H2YE08 A0A0M1V839 A0A0U1EV43 A0A208SCL4 Q0WJ31 Q665T9
gi|384137374|ref|YP_005520076.1| 214092.YPO0640 273123.YPTB3421 349746.YpAngola_A0308 360102.YPA_3152 377628.YPN_0499 386656.YPDSF_0423 502801.YPTS_3601 gi|186896899|ref|YP_001874011.1| gi|162419647|ref|YP_001604922.1| gi|294502711|ref|YP_003566773.1| gi|384416300|ref|YP_005625662.1| gi|108809143|ref|YP_653059.1| gi|384125024|ref|YP_005507638.1| gi|218927832|ref|YP_002345707.1| gi|108810664|ref|YP_646431.1| gi|51597719|ref|YP_071910.1| gi|384121144|ref|YP_005503764.1| WP_002210361.1.100083 WP_002210361.1.100246 WP_002210361.1.10066 WP_002210361.1.100921 WP_002210361.1.10105 WP_002210361.1.101305 WP_002210361.1.101382 WP_002210361.1.101928 WP_002210361.1.102012 WP_002210361.1.102067 WP_002210361.1.10736 WP_002210361.1.10935 WP_002210361.1.10955 WP_002210361.1.11693 WP_002210361.1.12463 WP_002210361.1.12736 WP_002210361.1.12857 WP_002210361.1.1388 WP_002210361.1.14063 WP_002210361.1.14804 WP_002210361.1.15321 WP_002210361.1.15555 WP_002210361.1.15605 WP_002210361.1.15689 WP_002210361.1.16243 WP_002210361.1.16333 WP_002210361.1.17135 WP_002210361.1.17141 WP_002210361.1.17608 WP_002210361.1.17873 WP_002210361.1.17983 WP_002210361.1.18208 WP_002210361.1.18640 WP_002210361.1.18826 WP_002210361.1.19329 WP_002210361.1.19425 WP_002210361.1.19739 WP_002210361.1.19763 WP_002210361.1.20035 WP_002210361.1.20380 WP_002210361.1.2064 WP_002210361.1.20932 WP_002210361.1.21486 WP_002210361.1.21784 WP_002210361.1.21879 WP_002210361.1.21934 WP_002210361.1.22530 WP_002210361.1.22542 WP_002210361.1.23157 WP_002210361.1.23271 WP_002210361.1.23687 WP_002210361.1.23811 WP_002210361.1.24002 WP_002210361.1.2451 WP_002210361.1.24517 WP_002210361.1.25181 WP_002210361.1.25394 WP_002210361.1.26383 WP_002210361.1.2640 WP_002210361.1.26509 WP_002210361.1.26776 WP_002210361.1.26960 WP_002210361.1.27124 WP_002210361.1.27251 WP_002210361.1.2726 WP_002210361.1.28647 WP_002210361.1.28922 WP_002210361.1.29157 WP_002210361.1.29355 WP_002210361.1.2947 WP_002210361.1.29622 WP_002210361.1.2964 WP_002210361.1.29685 WP_002210361.1.29814 WP_002210361.1.3092 WP_002210361.1.30931 WP_002210361.1.311 WP_002210361.1.31336 WP_002210361.1.31496 WP_002210361.1.31739 WP_002210361.1.31805 WP_002210361.1.32343 WP_002210361.1.32388 WP_002210361.1.32446 WP_002210361.1.32736 WP_002210361.1.33203 WP_002210361.1.33324 WP_002210361.1.33661 WP_002210361.1.33937 WP_002210361.1.34031 WP_002210361.1.34138 WP_002210361.1.35389 WP_002210361.1.35538 WP_002210361.1.36088 WP_002210361.1.37174 WP_002210361.1.37494 WP_002210361.1.37863 WP_002210361.1.38235 WP_002210361.1.38532 WP_002210361.1.38743 WP_002210361.1.38824 WP_002210361.1.38993 WP_002210361.1.39066 WP_002210361.1.39346 WP_002210361.1.3976 WP_002210361.1.39858 WP_002210361.1.40071 WP_002210361.1.40134 WP_002210361.1.40534 WP_002210361.1.40853 WP_002210361.1.41196 WP_002210361.1.4210 WP_002210361.1.42361 WP_002210361.1.42490 WP_002210361.1.42976 WP_002210361.1.44408 WP_002210361.1.44598 WP_002210361.1.44603 WP_002210361.1.44832 WP_002210361.1.45198 WP_002210361.1.45214 WP_002210361.1.46262 WP_002210361.1.46545 WP_002210361.1.46686 WP_002210361.1.46697 WP_002210361.1.46731 WP_002210361.1.4678 WP_002210361.1.46891 WP_002210361.1.47387 WP_002210361.1.47440 WP_002210361.1.47881 WP_002210361.1.48166 WP_002210361.1.48722 WP_002210361.1.4889 WP_002210361.1.49315 WP_002210361.1.49906 WP_002210361.1.4997 WP_002210361.1.50010 WP_002210361.1.50093 WP_002210361.1.50106 WP_002210361.1.50185 WP_002210361.1.50984 WP_002210361.1.51284 WP_002210361.1.51293 WP_002210361.1.51588 WP_002210361.1.51772 WP_002210361.1.51934 WP_002210361.1.52158 WP_002210361.1.52247 WP_002210361.1.52473 WP_002210361.1.52569 WP_002210361.1.52734 WP_002210361.1.52819 WP_002210361.1.52969 WP_002210361.1.53147 WP_002210361.1.53300 WP_002210361.1.53838 WP_002210361.1.53883 WP_002210361.1.53953 WP_002210361.1.54568 WP_002210361.1.54951 WP_002210361.1.55194 WP_002210361.1.55695 WP_002210361.1.5592 WP_002210361.1.56031 WP_002210361.1.56912 WP_002210361.1.56953 WP_002210361.1.57585 WP_002210361.1.57657 WP_002210361.1.58067 WP_002210361.1.58794 WP_002210361.1.59102 WP_002210361.1.59431 WP_002210361.1.5957 WP_002210361.1.59635 WP_002210361.1.59687 WP_002210361.1.59789 WP_002210361.1.59885 WP_002210361.1.60437 WP_002210361.1.60707 WP_002210361.1.60896 WP_002210361.1.61689 WP_002210361.1.62232 WP_002210361.1.62342 WP_002210361.1.6270 WP_002210361.1.63387 WP_002210361.1.63517 WP_002210361.1.63641 WP_002210361.1.64142 WP_002210361.1.64474 WP_002210361.1.64780 WP_002210361.1.64786 WP_002210361.1.64910 WP_002210361.1.653 WP_002210361.1.65400 WP_002210361.1.65554 WP_002210361.1.6570 WP_002210361.1.65706 WP_002210361.1.65718 WP_002210361.1.6581 WP_002210361.1.66118 WP_002210361.1.66546 WP_002210361.1.66616 WP_002210361.1.67404 WP_002210361.1.67850 WP_002210361.1.6791 WP_002210361.1.68361 WP_002210361.1.68371 WP_002210361.1.68753 WP_002210361.1.68855 WP_002210361.1.69018 WP_002210361.1.69316 WP_002210361.1.69951 WP_002210361.1.70117 WP_002210361.1.70171 WP_002210361.1.70377 WP_002210361.1.70417 WP_002210361.1.70726 WP_002210361.1.7083 WP_002210361.1.7169 WP_002210361.1.71744 WP_002210361.1.72280 WP_002210361.1.72440 WP_002210361.1.72486 WP_002210361.1.7402 WP_002210361.1.74310 WP_002210361.1.74577 WP_002210361.1.74738 WP_002210361.1.7518 WP_002210361.1.75208 WP_002210361.1.75337 WP_002210361.1.75407 WP_002210361.1.75636 WP_002210361.1.75689 WP_002210361.1.75821 WP_002210361.1.76555 WP_002210361.1.76670 WP_002210361.1.77387 WP_002210361.1.77429 WP_002210361.1.77691 WP_002210361.1.78004 WP_002210361.1.7841 WP_002210361.1.78556 WP_002210361.1.79515 WP_002210361.1.79550 WP_002210361.1.79981 WP_002210361.1.8009 WP_002210361.1.80331 WP_002210361.1.81848 WP_002210361.1.81877 WP_002210361.1.8210 WP_002210361.1.82133 WP_002210361.1.82151 WP_002210361.1.82270 WP_002210361.1.82436 WP_002210361.1.82619 WP_002210361.1.8303 WP_002210361.1.83039 WP_002210361.1.83265 WP_002210361.1.8420 WP_002210361.1.84703 WP_002210361.1.84720 WP_002210361.1.85269 WP_002210361.1.85270 WP_002210361.1.8559 WP_002210361.1.85802 WP_002210361.1.86034 WP_002210361.1.86059 WP_002210361.1.86413 WP_002210361.1.87107 WP_002210361.1.8728 WP_002210361.1.87418 WP_002210361.1.8762 WP_002210361.1.87853 WP_002210361.1.87988 WP_002210361.1.88362 WP_002210361.1.88472 WP_002210361.1.89359 WP_002210361.1.8964 WP_002210361.1.9051 WP_002210361.1.90624 WP_002210361.1.91373 WP_002210361.1.91844 WP_002210361.1.92030 WP_002210361.1.92331 WP_002210361.1.92604 WP_002210361.1.927 WP_002210361.1.9311 WP_002210361.1.9320 WP_002210361.1.93623 WP_002210361.1.93928 WP_002210361.1.93933 WP_002210361.1.94052 WP_002210361.1.94201 WP_002210361.1.94545 WP_002210361.1.94683 WP_002210361.1.95746 WP_002210361.1.95981 WP_002210361.1.97245 WP_002210361.1.97375 WP_002210361.1.97448 WP_002210361.1.97791 WP_002210361.1.97864 WP_002210361.1.97872 WP_002210361.1.97894 WP_002210361.1.99109 WP_002210361.1.99383 WP_002210361.1.9941 WP_002210361.1.99416 WP_002210361.1.99788 WP_002210361.1.99990 YP_002345707.1.25044 gi|145597733|ref|YP_001161809.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]