SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0H2WU09 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A0H2WU09
Domain Number - Region: 198-243
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.0484
Family Pseudo ankyrin repeat 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0H2WU09
Sequence length 327
Comment (tr|A0A0H2WU09|A0A0H2WU09_SALPA) Uncharacterized protein {ECO:0000313|EMBL:AAV78875.1} KW=Complete proteome OX=295319 OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42). GN=SPA3039 OC=Enterobacteriaceae; Salmonella.
Sequence
MQDASCYQLASVLTLAAEHRDTPENLLRYLAKIRGISPFLTAAESCPEAAIPNAEFLYTP
FATALRQHNVPIVRFFSQQLVGETSSARENRNIVARKENPLLTLYKSNYISQYREQYRLE
ISQLLLNIMPELLNDAVYIYPIIQRNTELVAYFWQKHPPTIPLRRLEAMVLLAKTKSLIS
EVTHNPEILITPPIEGWDRESLLTFILSNGDLAMIQSLIDANVVDWKRAMEDGNNEPLHQ
AILRLRGGALENALLIQIIKAMQAQKALSNEQIAHYLPWTPTFPAAFLQAGLSCEQLREV
LNALVVGSEQVLHDTRQRLNALCPVAK
Download sequence
Identical sequences A0A0H2WU09
gi|197364041|ref|YP_002143678.1| 295319.SPA3039 554290.SSPA2836 CP000026|CDS_3143494-3142511 FM200053|CDS_3139168-3138185 gi|459642597|ref|YP_152187.3|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]