SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0H2XVG4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0H2XVG4
Domain Number 1 Region: 35-152
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.0000000000471
Family SMI1/KNR4-like 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0H2XVG4
Sequence length 162
Comment (tr|A0A0H2XVG4|A0A0H2XVG4_BURCA) Uncharacterized protein {ECO:0000313|EMBL:ABF78240.1} KW=Complete proteome OX=331271 OS=Burkholderia cenocepacia (strain AU 1054). GN=Bcen_3345 OC=Burkholderiaceae; Burkholderia; Burkholderia cepacia complex.
Sequence
MRSIKEIVEIIRSDGRCQVLPASGKLPQLPHADMAYPNDMVEFYNLCGGVILFRPGKDNI
SFKILPAGDVLQTNMIIVGDPCEDDISFSWYAICKTDNGDYISIDTSKERNGRCYDSNFE
VHGVVGSCPIIALSFSELLDELYKSSGADIFWKAKDYGDAYA
Download sequence
Identical sequences A0A0H2XVG4 A0A2K0ML30
gi|107025702|ref|YP_623213.1| gi|116693116|ref|YP_838649.1| 331271.Bcen_3345 331272.Bcen2424_5022 WP_011547151.1.43430 WP_011547151.1.5376 WP_011547151.1.96618

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]