SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0H2YAX1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0H2YAX1
Domain Number 1 Region: 53-141
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.0000126
Family SMI1/KNR4-like 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0H2YAX1
Sequence length 158
Comment (tr|A0A0H2YAX1|A0A0H2YAX1_YERPA) Uncharacterized protein {ECO:0000313|EMBL:ABG15627.1} KW=Complete proteome OX=360102 OS=Yersinia pestis bv. Antiqua (strain Antiqua). GN=YPA_3665 OC=Yersiniaceae; Yersinia.
Sequence
MNTENKKLSTLIGKIHTIAKSRLAAGYEDRNGINEHQVTPCHHALTLLGGDDFAESYLPF
LRNVNGFDLNGVRLFGYFDDKGDERDLRKQLADLKAFPELFPDAFNDWVLIGETDTDILI
FNKKNGSYENRDRIGLDRLNESYDDIVGLLISLMPLIE
Download sequence
Identical sequences A0A0H2W8T7 A0A0H2YAX1 A0A0H2YMP3 A0A0H3B025 A0A0M1V969 A0A0U1EVK9 A0A0U1R2Z2 A0A208RZH5 A0A2A7VMP8 Q665E0 Q7CL60
gi|186897064|ref|YP_001874176.1| gi|108813679|ref|YP_649446.1| gi|145597575|ref|YP_001161651.1| gi|384138509|ref|YP_005521211.1| gi|153950718|ref|YP_001399377.1| gi|45443624|ref|NP_995163.1| gi|170022702|ref|YP_001719207.1| gi|294505247|ref|YP_003569309.1| 187410.y0215 214092.YPO3652 229193.YP_3895 273123.YPTB3578 349746.YpAngola_A1213 349747.YpsIP31758_0384 360102.YPA_3665 377628.YPN_3519 386656.YPDSF_0259 502800.YPK_0451 502801.YPTS_3766 gi|51597869|ref|YP_072060.1| gi|384416681|ref|YP_005626043.1| gi|108809656|ref|YP_653572.1| gi|218930662|ref|YP_002348537.1| gi|162421820|ref|YP_001605754.1| gi|384127648|ref|YP_005510262.1| WP_002210060.1.100083 WP_002210060.1.100246 WP_002210060.1.100593 WP_002210060.1.10066 WP_002210060.1.100921 WP_002210060.1.10105 WP_002210060.1.101305 WP_002210060.1.101382 WP_002210060.1.101928 WP_002210060.1.102012 WP_002210060.1.102067 WP_002210060.1.10736 WP_002210060.1.10935 WP_002210060.1.10955 WP_002210060.1.11693 WP_002210060.1.12167 WP_002210060.1.12463 WP_002210060.1.12736 WP_002210060.1.12857 WP_002210060.1.1388 WP_002210060.1.14063 WP_002210060.1.14169 WP_002210060.1.14804 WP_002210060.1.15321 WP_002210060.1.15555 WP_002210060.1.15605 WP_002210060.1.15689 WP_002210060.1.16243 WP_002210060.1.16333 WP_002210060.1.17135 WP_002210060.1.17141 WP_002210060.1.17608 WP_002210060.1.17873 WP_002210060.1.17983 WP_002210060.1.18208 WP_002210060.1.18640 WP_002210060.1.18826 WP_002210060.1.19425 WP_002210060.1.19739 WP_002210060.1.19763 WP_002210060.1.20380 WP_002210060.1.20547 WP_002210060.1.2064 WP_002210060.1.20932 WP_002210060.1.21486 WP_002210060.1.21784 WP_002210060.1.21879 WP_002210060.1.21934 WP_002210060.1.22530 WP_002210060.1.22542 WP_002210060.1.23157 WP_002210060.1.23271 WP_002210060.1.23687 WP_002210060.1.23811 WP_002210060.1.24002 WP_002210060.1.2451 WP_002210060.1.24517 WP_002210060.1.25181 WP_002210060.1.25394 WP_002210060.1.26383 WP_002210060.1.2640 WP_002210060.1.26776 WP_002210060.1.26960 WP_002210060.1.27124 WP_002210060.1.27251 WP_002210060.1.2726 WP_002210060.1.28647 WP_002210060.1.28922 WP_002210060.1.29157 WP_002210060.1.29186 WP_002210060.1.29355 WP_002210060.1.2947 WP_002210060.1.29622 WP_002210060.1.2964 WP_002210060.1.29685 WP_002210060.1.29814 WP_002210060.1.3092 WP_002210060.1.30931 WP_002210060.1.311 WP_002210060.1.31336 WP_002210060.1.31496 WP_002210060.1.31721 WP_002210060.1.31739 WP_002210060.1.31805 WP_002210060.1.32343 WP_002210060.1.32388 WP_002210060.1.32446 WP_002210060.1.32736 WP_002210060.1.33203 WP_002210060.1.33324 WP_002210060.1.33661 WP_002210060.1.33775 WP_002210060.1.33937 WP_002210060.1.34031 WP_002210060.1.34138 WP_002210060.1.35389 WP_002210060.1.35538 WP_002210060.1.36088 WP_002210060.1.37174 WP_002210060.1.37494 WP_002210060.1.37863 WP_002210060.1.38235 WP_002210060.1.38532 WP_002210060.1.38743 WP_002210060.1.38824 WP_002210060.1.38993 WP_002210060.1.39066 WP_002210060.1.3976 WP_002210060.1.39858 WP_002210060.1.40071 WP_002210060.1.40134 WP_002210060.1.40534 WP_002210060.1.40853 WP_002210060.1.41196 WP_002210060.1.4210 WP_002210060.1.42361 WP_002210060.1.42490 WP_002210060.1.42976 WP_002210060.1.44408 WP_002210060.1.44598 WP_002210060.1.44832 WP_002210060.1.45198 WP_002210060.1.45214 WP_002210060.1.46262 WP_002210060.1.46545 WP_002210060.1.46686 WP_002210060.1.46697 WP_002210060.1.46731 WP_002210060.1.4678 WP_002210060.1.46891 WP_002210060.1.47387 WP_002210060.1.47881 WP_002210060.1.48166 WP_002210060.1.48722 WP_002210060.1.4889 WP_002210060.1.49315 WP_002210060.1.49906 WP_002210060.1.4997 WP_002210060.1.50010 WP_002210060.1.50093 WP_002210060.1.50185 WP_002210060.1.50984 WP_002210060.1.51284 WP_002210060.1.51293 WP_002210060.1.51588 WP_002210060.1.51772 WP_002210060.1.51934 WP_002210060.1.52158 WP_002210060.1.52247 WP_002210060.1.52473 WP_002210060.1.52734 WP_002210060.1.52792 WP_002210060.1.52819 WP_002210060.1.53147 WP_002210060.1.53300 WP_002210060.1.53838 WP_002210060.1.53848 WP_002210060.1.53883 WP_002210060.1.53953 WP_002210060.1.54568 WP_002210060.1.54951 WP_002210060.1.55194 WP_002210060.1.55695 WP_002210060.1.5592 WP_002210060.1.56031 WP_002210060.1.56912 WP_002210060.1.57585 WP_002210060.1.57657 WP_002210060.1.58067 WP_002210060.1.58543 WP_002210060.1.58794 WP_002210060.1.59102 WP_002210060.1.59431 WP_002210060.1.5957 WP_002210060.1.59635 WP_002210060.1.5968 WP_002210060.1.59789 WP_002210060.1.59885 WP_002210060.1.60437 WP_002210060.1.60707 WP_002210060.1.60896 WP_002210060.1.62232 WP_002210060.1.62342 WP_002210060.1.6270 WP_002210060.1.6333 WP_002210060.1.63387 WP_002210060.1.63641 WP_002210060.1.64142 WP_002210060.1.64474 WP_002210060.1.64780 WP_002210060.1.64786 WP_002210060.1.64910 WP_002210060.1.653 WP_002210060.1.65400 WP_002210060.1.65554 WP_002210060.1.6570 WP_002210060.1.65706 WP_002210060.1.65718 WP_002210060.1.6581 WP_002210060.1.66118 WP_002210060.1.66546 WP_002210060.1.66616 WP_002210060.1.67404 WP_002210060.1.67850 WP_002210060.1.6791 WP_002210060.1.68361 WP_002210060.1.68371 WP_002210060.1.68753 WP_002210060.1.68855 WP_002210060.1.69018 WP_002210060.1.69316 WP_002210060.1.69951 WP_002210060.1.70117 WP_002210060.1.70171 WP_002210060.1.70319 WP_002210060.1.70377 WP_002210060.1.70417 WP_002210060.1.70726 WP_002210060.1.7083 WP_002210060.1.7169 WP_002210060.1.71744 WP_002210060.1.72280 WP_002210060.1.72440 WP_002210060.1.72486 WP_002210060.1.7402 WP_002210060.1.74131 WP_002210060.1.74310 WP_002210060.1.74577 WP_002210060.1.74738 WP_002210060.1.75169 WP_002210060.1.75208 WP_002210060.1.75337 WP_002210060.1.75407 WP_002210060.1.75636 WP_002210060.1.75689 WP_002210060.1.76555 WP_002210060.1.76670 WP_002210060.1.77295 WP_002210060.1.77387 WP_002210060.1.77429 WP_002210060.1.77569 WP_002210060.1.77691 WP_002210060.1.78004 WP_002210060.1.7841 WP_002210060.1.78556 WP_002210060.1.79515 WP_002210060.1.79550 WP_002210060.1.79825 WP_002210060.1.79981 WP_002210060.1.8009 WP_002210060.1.80331 WP_002210060.1.81848 WP_002210060.1.81877 WP_002210060.1.8210 WP_002210060.1.82133 WP_002210060.1.82151 WP_002210060.1.82270 WP_002210060.1.82436 WP_002210060.1.82619 WP_002210060.1.8303 WP_002210060.1.83039 WP_002210060.1.83265 WP_002210060.1.8420 WP_002210060.1.84703 WP_002210060.1.84720 WP_002210060.1.85269 WP_002210060.1.85270 WP_002210060.1.8559 WP_002210060.1.85802 WP_002210060.1.86034 WP_002210060.1.86059 WP_002210060.1.86413 WP_002210060.1.87107 WP_002210060.1.8728 WP_002210060.1.87418 WP_002210060.1.8762 WP_002210060.1.87853 WP_002210060.1.87988 WP_002210060.1.88362 WP_002210060.1.88472 WP_002210060.1.89359 WP_002210060.1.8964 WP_002210060.1.90176 WP_002210060.1.9051 WP_002210060.1.90624 WP_002210060.1.91373 WP_002210060.1.91844 WP_002210060.1.92030 WP_002210060.1.92331 WP_002210060.1.92604 WP_002210060.1.927 WP_002210060.1.9311 WP_002210060.1.9320 WP_002210060.1.93623 WP_002210060.1.93928 WP_002210060.1.94052 WP_002210060.1.94201 WP_002210060.1.94545 WP_002210060.1.94683 WP_002210060.1.95746 WP_002210060.1.95981 WP_002210060.1.97245 WP_002210060.1.97375 WP_002210060.1.97448 WP_002210060.1.97791 WP_002210060.1.97864 WP_002210060.1.97894 WP_002210060.1.99109 WP_002210060.1.99383 WP_002210060.1.9941 WP_002210060.1.99416 WP_002210060.1.99788 WP_002210060.1.99882 WP_002210060.1.99972 WP_002210060.1.99990 YP_002348537.1.25044 gi|384123714|ref|YP_005506334.1| gi|22124135|ref|NP_667558.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]