SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0H2YKE7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A0H2YKE7
Domain Number - Region: 50-156
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.00902
Family SMI1/KNR4-like 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0H2YKE7
Sequence length 162
Comment (tr|A0A0H2YKE7|A0A0H2YKE7_YERPN) Uncharacterized protein {ECO:0000313|EMBL:ABG19046.1} KW=Complete proteome OX=377628 OS=Yersinia pestis bv. Antiqua (strain Nepal516). GN=YPN_2719 OC=Yersiniaceae; Yersinia.
Sequence
MTQLNNIVDELNSLALKLEYDVLPPAVFPSSLYEYDFGLKIGKAPQEFWDQYKALVELAD
GFDLDGFRMYGIEKHGDYENDLFTYNGYKARLDKEAPSLMSDESRYCIEIGSSSLDTYTY
DVRYGKWESRDRVQYDNLFISCSNLIDFLAAILAEIREANVQ
Download sequence
Identical sequences A0A0E1NZ71 A0A0H2YKE7 A0A0M1VCI9 A0A0U1QWV1 A0A208S065 Q0WHF2
gi|162421285|ref|YP_001605994.1| gi|384415393|ref|YP_005624755.1| gi|384121706|ref|YP_005504326.1| WP_002208840.1.100083 WP_002208840.1.100593 WP_002208840.1.100921 WP_002208840.1.10105 WP_002208840.1.101305 WP_002208840.1.101382 WP_002208840.1.101928 WP_002208840.1.102012 WP_002208840.1.102067 WP_002208840.1.10736 WP_002208840.1.10935 WP_002208840.1.10955 WP_002208840.1.11693 WP_002208840.1.12167 WP_002208840.1.12463 WP_002208840.1.12857 WP_002208840.1.1388 WP_002208840.1.14063 WP_002208840.1.14169 WP_002208840.1.14804 WP_002208840.1.15321 WP_002208840.1.15555 WP_002208840.1.15605 WP_002208840.1.15689 WP_002208840.1.16243 WP_002208840.1.16333 WP_002208840.1.17135 WP_002208840.1.17141 WP_002208840.1.17608 WP_002208840.1.17873 WP_002208840.1.17983 WP_002208840.1.18208 WP_002208840.1.18640 WP_002208840.1.18826 WP_002208840.1.19329 WP_002208840.1.19425 WP_002208840.1.19739 WP_002208840.1.19763 WP_002208840.1.2064 WP_002208840.1.21784 WP_002208840.1.21879 WP_002208840.1.21934 WP_002208840.1.22542 WP_002208840.1.23157 WP_002208840.1.23271 WP_002208840.1.23687 WP_002208840.1.23811 WP_002208840.1.24002 WP_002208840.1.2451 WP_002208840.1.25181 WP_002208840.1.2640 WP_002208840.1.26776 WP_002208840.1.26960 WP_002208840.1.27124 WP_002208840.1.27251 WP_002208840.1.2726 WP_002208840.1.28647 WP_002208840.1.29157 WP_002208840.1.29186 WP_002208840.1.29355 WP_002208840.1.2947 WP_002208840.1.29622 WP_002208840.1.2964 WP_002208840.1.29685 WP_002208840.1.29814 WP_002208840.1.3092 WP_002208840.1.30931 WP_002208840.1.311 WP_002208840.1.31336 WP_002208840.1.31496 WP_002208840.1.31721 WP_002208840.1.31739 WP_002208840.1.31805 WP_002208840.1.32343 WP_002208840.1.32446 WP_002208840.1.33203 WP_002208840.1.33775 WP_002208840.1.33937 WP_002208840.1.34031 WP_002208840.1.34138 WP_002208840.1.35389 WP_002208840.1.35538 WP_002208840.1.36088 WP_002208840.1.37174 WP_002208840.1.37494 WP_002208840.1.37863 WP_002208840.1.38235 WP_002208840.1.38824 WP_002208840.1.38993 WP_002208840.1.39066 WP_002208840.1.3976 WP_002208840.1.40071 WP_002208840.1.40134 WP_002208840.1.40534 WP_002208840.1.40853 WP_002208840.1.41196 WP_002208840.1.41984 WP_002208840.1.4210 WP_002208840.1.42490 WP_002208840.1.44408 WP_002208840.1.44832 WP_002208840.1.45198 WP_002208840.1.45214 WP_002208840.1.46262 WP_002208840.1.46545 WP_002208840.1.46686 WP_002208840.1.46731 WP_002208840.1.4678 WP_002208840.1.46891 WP_002208840.1.47387 WP_002208840.1.47440 WP_002208840.1.48722 WP_002208840.1.4997 WP_002208840.1.50010 WP_002208840.1.50093 WP_002208840.1.50984 WP_002208840.1.51284 WP_002208840.1.51293 WP_002208840.1.51588 WP_002208840.1.51772 WP_002208840.1.51934 WP_002208840.1.52158 WP_002208840.1.52247 WP_002208840.1.52734 WP_002208840.1.52819 WP_002208840.1.53300 WP_002208840.1.53838 WP_002208840.1.53848 WP_002208840.1.53953 WP_002208840.1.54568 WP_002208840.1.54951 WP_002208840.1.55194 WP_002208840.1.5592 WP_002208840.1.56031 WP_002208840.1.56912 WP_002208840.1.57585 WP_002208840.1.57657 WP_002208840.1.58067 WP_002208840.1.58543 WP_002208840.1.58794 WP_002208840.1.59102 WP_002208840.1.59431 WP_002208840.1.5957 WP_002208840.1.59635 WP_002208840.1.5968 WP_002208840.1.59789 WP_002208840.1.59885 WP_002208840.1.60437 WP_002208840.1.60707 WP_002208840.1.60896 WP_002208840.1.62232 WP_002208840.1.62342 WP_002208840.1.6270 WP_002208840.1.6333 WP_002208840.1.63387 WP_002208840.1.64142 WP_002208840.1.64474 WP_002208840.1.64780 WP_002208840.1.64786 WP_002208840.1.64910 WP_002208840.1.653 WP_002208840.1.65400 WP_002208840.1.65554 WP_002208840.1.6570 WP_002208840.1.65706 WP_002208840.1.65718 WP_002208840.1.6581 WP_002208840.1.66118 WP_002208840.1.66546 WP_002208840.1.66616 WP_002208840.1.67404 WP_002208840.1.67850 WP_002208840.1.68361 WP_002208840.1.68753 WP_002208840.1.69018 WP_002208840.1.69316 WP_002208840.1.69951 WP_002208840.1.70117 WP_002208840.1.70171 WP_002208840.1.70319 WP_002208840.1.70377 WP_002208840.1.70417 WP_002208840.1.70726 WP_002208840.1.7083 WP_002208840.1.7169 WP_002208840.1.71744 WP_002208840.1.72280 WP_002208840.1.72440 WP_002208840.1.72486 WP_002208840.1.7402 WP_002208840.1.74131 WP_002208840.1.74310 WP_002208840.1.74577 WP_002208840.1.74738 WP_002208840.1.75169 WP_002208840.1.7518 WP_002208840.1.75337 WP_002208840.1.75636 WP_002208840.1.75689 WP_002208840.1.76670 WP_002208840.1.77295 WP_002208840.1.77387 WP_002208840.1.77429 WP_002208840.1.77569 WP_002208840.1.78004 WP_002208840.1.7841 WP_002208840.1.78556 WP_002208840.1.79550 WP_002208840.1.79825 WP_002208840.1.79981 WP_002208840.1.8009 WP_002208840.1.80331 WP_002208840.1.81848 WP_002208840.1.81877 WP_002208840.1.8210 WP_002208840.1.82133 WP_002208840.1.82151 WP_002208840.1.82270 WP_002208840.1.82619 WP_002208840.1.8303 WP_002208840.1.83039 WP_002208840.1.83265 WP_002208840.1.83630 WP_002208840.1.8420 WP_002208840.1.84703 WP_002208840.1.84720 WP_002208840.1.85269 WP_002208840.1.85270 WP_002208840.1.8559 WP_002208840.1.85802 WP_002208840.1.86034 WP_002208840.1.86413 WP_002208840.1.87107 WP_002208840.1.8728 WP_002208840.1.87418 WP_002208840.1.8762 WP_002208840.1.87853 WP_002208840.1.87988 WP_002208840.1.88362 WP_002208840.1.88472 WP_002208840.1.89359 WP_002208840.1.89542 WP_002208840.1.8964 WP_002208840.1.90176 WP_002208840.1.9051 WP_002208840.1.90624 WP_002208840.1.91373 WP_002208840.1.92030 WP_002208840.1.92331 WP_002208840.1.92604 WP_002208840.1.9311 WP_002208840.1.9320 WP_002208840.1.93623 WP_002208840.1.93928 WP_002208840.1.94052 WP_002208840.1.94201 WP_002208840.1.94545 WP_002208840.1.94683 WP_002208840.1.95746 WP_002208840.1.95981 WP_002208840.1.97245 WP_002208840.1.97375 WP_002208840.1.97448 WP_002208840.1.97791 WP_002208840.1.97864 WP_002208840.1.97894 WP_002208840.1.99109 WP_002208840.1.99383 WP_002208840.1.99416 WP_002208840.1.99972 WP_002208840.1.99990 YP_002346286.1.25044 214092.YPO1257 349746.YpAngola_A1480 349747.YpsIP31758_2726 377628.YPN_2719 386656.YPDSF_2437 gi|294503263|ref|YP_003567325.1| gi|153948131|ref|YP_001401691.1| gi|108812879|ref|YP_648646.1| gi|384140968|ref|YP_005523670.1| gi|145599708|ref|YP_001163784.1| gi|218928411|ref|YP_002346286.1| gi|384125496|ref|YP_005508110.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]