SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0H2YS61 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0H2YS61
Domain Number 1 Region: 1-106
Classification Level Classification E-value
Superfamily LigT-like 0.00000000259
Family tRNA splicing product Appr>p cyclic nucleotide phosphodiesterase 0.081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0H2YS61
Sequence length 181
Comment (tr|A0A0H2YS61|A0A0H2YS61_CLOP1) Uncharacterized protein {ECO:0000313|EMBL:ABG83826.1} KW=Complete proteome OX=195103 OS=NCIMB 6125 / NCTC 8237 / Type A). GN=CPF_2934 OC=Clostridium.
Sequence
MKYYLVALFDEESCKSLESLQRGLLRKYKLPRNHISLHIPLETIDNPNLDKLDEVVLKLI
KPYKKFKIELTGSAEFNESTNKALNLQIENKGYIKKIHRLFNDMLKLHGFNVRERVDSPL
YIPINTPNFKENHKKNNTQPTVFNLRESSQKNILKISKIELWRFQNNKREIPVKSYDLRN
Y
Download sequence
Identical sequences A0A0H2YS61
195103.CPF_2934 gi|110800192|ref|YP_697298.1| WP_011591184.1.50147

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]