SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0H3AY85 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0H3AY85
Domain Number 1 Region: 195-240,284-383
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.0000000275
Family Pseudo ankyrin repeat 0.021
Further Details:      
 
Domain Number 2 Region: 370-460
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.0000353
Family Pseudo ankyrin repeat 0.013
Further Details:      
 
Weak hits

Sequence:  A0A0H3AY85
Domain Number - Region: 484-585
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.000314
Family Pseudo ankyrin repeat 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0H3AY85
Sequence length 616
Comment (tr|A0A0H3AY85|A0A0H3AY85_RICRS) Uncharacterized protein {ECO:0000313|EMBL:ABV76526.1} KW=Complete proteome OX=392021 OS=Rickettsia rickettsii (strain Sheila Smith). GN=A1G_05165 OC=Rickettsiaceae; Rickettsieae; Rickettsia; spotted fever group.
Sequence
MQKILFKGPNISMKNENPDIKEIKTLADLPSGTGSEYFINVHGSEFFCKPTDLGLWGKIK
SYFMPESSYLLMNIFSDEGTTPVLDITLLNKIQNNTTANQCNIVHIFSCHSGAAQHHLDW
IQGNIVLCTYNKASDANIMRLAQNNYDARTKNNSLLIEYIRDHFHLLVASDFSISYKLDN
QIYSFSLSANKIKQMKSIEELPAFLHKEYKAFVKFYENIHAKYHESYPEIFNLNIETKPK
ELTYDDLIKVFSRALTLETYNFNKFSLSKIETMLNQKGLCTDTSIRHAIEHGNSELLICL
LNYGNTKVSTYTLDKAIEKGDLAILKAVLEHSTTKIEPYTLDKAIEKGDLAILKAVLEHS
TTKIESYNLDKAIEEGDLAILKAVLEHSTTKIEPYTLDKAIEKGDLAILKAVLEHSTTKI
ESYNLDKAIEEGDLAILKAVLEHSTTKIEPYNLGKVIEKGDLAILKAVLEHSTTKIELYN
LGKAIEKGDLAILKAILEHSTTKIELYNLGKAIEKGDLAILKAVLEHSTTKIALYNLGEA
IEEGDLAILKAVLEHSTIEVGSSNIYTAEETHNLDVIELVKKYSTINTITSEENTIDTTL
TVVEEVPALGEGTEGV
Download sequence
Identical sequences A0A0H3AY85
WP_012151093.1.4490 gi|157828792|ref|YP_001495034.1| 392021.A1G_05165

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]