SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0H3B193 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0H3B193
Domain Number 1 Region: 61-157
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.0000249
Family SMI1/KNR4-like 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0H3B193
Sequence length 176
Comment (tr|A0A0H3B193|A0A0H3B193_YERPY) Uncharacterized protein {ECO:0000313|EMBL:ACA66914.1} KW=Complete proteome OX=502800 OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII). GN=YPK_0611 OC=Yersiniaceae; Yersinia.
Sequence
MIEIKTLLEHDNVKELTKYVDEIYSISRSLAKYGVEACSGLKDPGSVNITEAMQVLIKMG
GQTFANEYLRFLYFLNGFSLNGTTMYGIFSDEQNIRDIRRARANLHEVPELYPVEFDDYV
FIGHNETDVVIFNQISEKFELRDRIGTVDTLWDSFDDIPSLLKVLIDNLRPAPDIE
Download sequence
Identical sequences A0A0E8XRJ6 A0A0H3B193 A0A0T9JCJ8 A0A0U1QYV3
gi|153948977|ref|YP_001399543.1| WP_012104462.1.12167 WP_012104462.1.14169 WP_012104462.1.26509 WP_012104462.1.41984 WP_012104462.1.42976 WP_012104462.1.47769 WP_012104462.1.52473 WP_012104462.1.52792 WP_012104462.1.58543 WP_012104462.1.6333 WP_012104462.1.63517 WP_012104462.1.76555 WP_012104462.1.7939 WP_012104462.1.83630 WP_012104462.1.89542 WP_012104462.1.99882 gi|170022862|ref|YP_001719367.1| 349747.YpsIP31758_0550 502800.YPK_0611

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]