SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0H3C3T7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A0H3C3T7
Domain Number - Region: 6-140
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.051
Family Pseudo ankyrin repeat 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0H3C3T7
Sequence length 287
Comment (tr|A0A0H3C3T7|A0A0H3C3T7_BORBZ) Uncharacterized protein {ECO:0000313|EMBL:ACK74944.1} KW=Complete proteome OX=445985 OS=Borrelia burgdorferi (strain ZS7). GN=BbuZS7_0695 OC=Bacteria; Spirochaetes; Spirochaetales; Borreliaceae; Borreliella.
Sequence
MNTKPYFPYLYHYLFNHESIKSLSAIEKEIEILNYLKENKKTIATFIKNDFESEIKDLIQ
YVKDKTDIIITPFVLSGIEAIDFNIVKPLFSKELTKNDLNLIFNFVKVNSSLRKEFFYNF
NTISNGYITFYINKLFEGKNSYTIYLIQKENKALYSSDIIKNYIKILLLLKVLVIKYCFE
KGIELTTKNIESTSKAISNDTDFLDEKTAKLIIESFFKYETLQTMSPISTLIAIFSARAR
TPKYKNNPVKGFIGYDESWFSIKQSGSREYDSRIIKELSEIAKVNKW
Download sequence
Identical sequences A0A0H3C3T7
445985.BbuZS7_0695 WP_012597380.1.18535 WP_012597380.1.35366 WP_012597380.1.54040 WP_012597380.1.91101 WP_012597380.1.96090 WP_012597380.1.96757 gi|218249695|ref|YP_002375175.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]