SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0H3CHL3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0H3CHL3
Domain Number 1 Region: 8-155
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.00000000000000811
Family SMI1/KNR4-like 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0H3CHL3
Sequence length 160
Comment (tr|A0A0H3CHL3|A0A0H3CHL3_ENTCC) Uncharacterized protein {ECO:0000313|EMBL:ADF61135.1} KW=Complete proteome OX=716541 OS=NBRC 13535 / NCDC 279-56). GN=ECL_01576 OC=Enterobacteriaceae; Enterobacter; Enterobacter cloacae complex.
Sequence
MNHFSNCEKKIGRADIAKNEEELSIILPDDFISHYLQFNGGTPEKSWWADDEDFEPVEVA
GFKPFIYNSHTNDDPRSLIDGCYISMLDRQVIPENLFPFANDWGGNFFCLDLDDYSIVYF
ATDSFDEYLTMQENHIKLQRYLTNSFSNFVNGLVTEEDLS
Download sequence
Identical sequences A0A0H3CHL3 A0A0M7JIA7
gi|296101938|ref|YP_003612084.1| WP_013096214.1.40358 WP_013096214.1.55189 WP_013096214.1.92861 YP_003612084.1.53031

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]