SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0H3CJT3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0H3CJT3
Domain Number 1 Region: 7-165
Classification Level Classification E-value
Superfamily N5-CAIR mutase (phosphoribosylaminoimidazole carboxylase, PurE) 1.57e-66
Family N5-CAIR mutase (phosphoribosylaminoimidazole carboxylase, PurE) 0.000000048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0H3CJT3
Sequence length 169
Comment (tr|A0A0H3CJT3|A0A0H3CJT3_ENTCC) 5-(carboxyamino)imidazole ribonucleotide mutase {ECO:0000256|HAMAP-Rule:MF_01929} KW=Complete proteome OX=716541 OS=NBRC 13535 / NCDC 279-56). GN=ECL_01267 OC=Enterobacteriaceae; Enterobacter; Enterobacter cloacae complex.
Sequence
MSSRNNPARVAIVMGSKSDWATMQFAAEIFEILNVPHHVEVVSAHRTPDKLFSFAESAQE
NGYEVIIAGAGGAAHLPGMIAAKTLVPVLGVPVQSAALSGVDSLYSIVQMPRGIPVGTLA
IGKAGAANAALLAAQILATHDKALHQRLADWRKAQTDEVLDNPDPRGAA
Download sequence
Identical sequences A0A0F0TUM0 A0A0H3CJT3 A0A0M7DN73 A0A1B3EYG9
gi|296101631|ref|YP_003611777.1| WP_013095919.1.12136 WP_013095919.1.13165 WP_013095919.1.18853 WP_013095919.1.20094 WP_013095919.1.20623 WP_013095919.1.30503 WP_013095919.1.35593 WP_013095919.1.40063 WP_013095919.1.40358 WP_013095919.1.40370 WP_013095919.1.43855 WP_013095919.1.55189 WP_013095919.1.59627 WP_013095919.1.63227 WP_013095919.1.68308 WP_013095919.1.71263 WP_013095919.1.7582 WP_013095919.1.7743 WP_013095919.1.83767 WP_013095919.1.8463 WP_013095919.1.8730 WP_013095919.1.90350 WP_013095919.1.92861 WP_013095919.1.97911 WP_013095919.1.99766 WP_013095919.1.99932 YP_003611777.1.53031 gi|392977945|ref|YP_006476533.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]