SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0H3CM34 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0H3CM34
Domain Number 1 Region: 26-161
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 3.27e-16
Family SMI1/KNR4-like 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0H3CM34
Sequence length 180
Comment (tr|A0A0H3CM34|A0A0H3CM34_ENTCC) Uncharacterized protein {ECO:0000313|EMBL:ADF62673.1} KW=Complete proteome OX=716541 OS=NBRC 13535 / NCDC 279-56). GN=ECL_03137 OC=Enterobacteriaceae; Enterobacter; Enterobacter cloacae complex.
Sequence
MKKLERFGAKSTPLLLDELKKNLHTLETSIGPIPESYRAYLLHFGVSALFDVNILFKPLQ
PSPWSDEQGNDTLESLYGLAESGKEYTVFEMTDIYRNDFRDQWLPIGASSGDNQICLCLK
GDMSGEIWFWDHESDPIFNHSVVTSGLTKIANSFDEFVDMLTAQNDKIDASGVVKVDLDF
Download sequence
Identical sequences A0A0H3CM34
YP_003613622.1.53031 gi|296103476|ref|YP_003613622.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]