SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0H3CMW0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0H3CMW0
Domain Number 1 Region: 5-158
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 8.11e-19
Family SMI1/KNR4-like 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0H3CMW0
Sequence length 173
Comment (tr|A0A0H3CMW0|A0A0H3CMW0_ENTCC) Uncharacterized protein {ECO:0000313|EMBL:ADF62674.1} KW=Complete proteome OX=716541 OS=NBRC 13535 / NCDC 279-56). GN=ECL_03138 OC=Enterobacteriaceae; Enterobacter; Enterobacter cloacae complex.
Sequence
MPISCGKPTTQDEIKILEVKFKISLPEDYKEFLRLKNGFVVKSPDFCELEYEGVDEGVIA
FYALFGINMKNPNHDIFRQNENVLSELDFIDDKLIIGDDPGGNFYLILNGSESQGLYYWD
RTHLHAEDDIQEFEIAEKNECGNIYKITNGFTEFYKKICEISLDAGMNVTVDL
Download sequence
Identical sequences A0A0H3CMW0 A0A0M7IAK9
WP_013097663.1.40358 WP_013097663.1.55189 WP_013097663.1.92861 YP_003613623.1.53031 gi|296103477|ref|YP_003613623.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]