SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0H3D3B5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A0H3D3B5
Domain Number - Region: 29-131
Classification Level Classification E-value
Superfamily Mog1p/PsbP-like 0.000136
Family PA0094-like 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0H3D3B5
Sequence length 157
Comment (tr|A0A0H3D3B5|A0A0H3D3B5_AMYMU) Uncharacterized protein {ECO:0000313|EMBL:ADJ44041.1} KW=Complete proteome OX=749927 OS=Amycolatopsis mediterranei (strain U-32). GN=AMED_2242 OC=Amycolatopsis.
Sequence
MMTLPLDFVIPDGWTAVDPGDSGAVFVAVHPVPGEEFTPNITVSVQQRPDEASIDAIAAE
AVERLSRTLAGLEVLSRRDVGDPAAPAVMQLLRLRTGEGTELIQTQVHLTVPGATPEDRL
VLELACTAAPATARALSPGFQRFVASVHVRQHEGKAQ
Download sequence
Identical sequences A0A0H3D3B5
gi|399536037|ref|YP_006548699.1| WP_013224118.1.26188 WP_013224118.1.53613 WP_013224118.1.63706 WP_013224118.1.79787 WP_013224118.1.88400 WP_013224118.1.99940 YP_003764443.1.66228 gi|300784152|ref|YP_003764443.1| gi|399536037|ref|YP_006548699.1| gi|532458899|ref|YP_008458551.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]