SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0H3E3J1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A0H3E3J1
Domain Number - Region: 6-43
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.000353
Family SMI1/KNR4-like 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0H3E3J1
Sequence length 43
Comment (tr|A0A0H3E3J1|A0A0H3E3J1_BACA1) YobK {ECO:0000313|EMBL:ADP33752.1} KW=Complete proteome; Reference proteome OX=720555 OS=Bacillus atrophaeus (strain 1942). GN=BATR1942_14150 OC=Bacteria; Firmicutes; Bacilli; Bacillales; Bacillaceae; Bacillus.
Sequence
MFVGFKNYGSGGIYGIDILNYDFGRASVVEKTKEFREYNELPK
Download sequence
Identical sequences A0A0H3E3J1
gi|311069760|ref|YP_003974683.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]