SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0H3FWU5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A0H3FWU5
Domain Number - Region: 272-308
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.0267
Family SMI1/KNR4-like 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0H3FWU5
Sequence length 340
Comment (tr|A0A0H3FWU5|A0A0H3FWU5_ZYMMA) 4-hydroxy-3-methylbut-2-enyl diphosphate reductase {ECO:0000256|HAMAP-Rule:MF_00191, ECO:0000256|SAAS:SAAS01001099} KW=Complete proteome OX=555217 OS=404 / NCIMB 8938 / NRRL B-806 / ZM1). GN=Zmob_0422 OC=Sphingomonadaceae; Zymomonas.
Sequence
MIKIILAQPRGFCAGVIRAIEIVDQALDRVGAPVYVRHEIVHNRHVVDTLKAKGAVFVEE
LSEVPPGEVTVFSAHGVARTVQKEAEERGLPVVDATCPLVNKVHAQGRRYLSHGRTLILI
GHAGHPEIEGTLGQIDGPVHLVGSAEQVDSLDIPSDTPVAFITQTTLSVDDTRSVIAALR
KKFTDVIGPDTSDICYATQNRQAAVRDLCKQSDLILVVGSPNSSNSNRLREIGLEEGLPS
YLIADGSEIDPVWFEGINTVGLTAGASAPEELVQSVITAIRALGPVTVEQLDGVEEKIAF
RLPPTLRHLKARNAAHNNLDNKTAASEEADSLSNDTEQEA
Download sequence
Identical sequences A0A0H3FWU5 Q5NP61
gi|560136351|ref|YP_008832980.1| 264203.ZMO0875 622759.Za10_0417 gi|397676304|ref|YP_006517842.1| gi|260752658|ref|YP_003225551.1| gi|384411355|ref|YP_005620720.1| WP_011240741.1.26972 WP_011240741.1.32473 WP_011240741.1.33991 WP_011240741.1.34904 WP_011240741.1.41889 WP_011240741.1.4952 WP_011240741.1.67824 WP_011240741.1.73175 WP_011240741.1.74559 WP_011240741.1.88046 gi|56551771|ref|YP_162610.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]