SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0H3I3L2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0H3I3L2
Domain Number 1 Region: 28-166
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.00000085
Family SMI1/KNR4-like 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0H3I3L2
Sequence length 174
Comment (tr|A0A0H3I3L2|A0A0H3I3L2_PECSS) Uncharacterized protein {ECO:0000313|EMBL:AFI88400.1} KW=Complete proteome OX=1905730 OS=Pectobacterium sp. (strain SCC3193). GN=W5S_0273 OC=Pectobacteriaceae; Pectobacterium.
Sequence
MTIEKTDLNNWDMDEPNFIPDVNKINSSITFIQNELKVIIPNEMQELMFLTNDKPIGPTE
GIDSVLVKYNDKTIIINIEITYSSNYIVEYTKLSQESIYEKRFLLPNGLIVIGSSYDDAG
YACLIYDVRPDSVTYKHVFHWRHYVDNLIMGEGLGLIAHSLKEFLSMPTSEDAL
Download sequence
Identical sequences A0A0H3I3L2
WP_014698507.1.36680 WP_014698507.1.77019 WP_014698507.1.78307 gi|470152770|ref|YP_006281272.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]