SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0H3IBS6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0H3IBS6
Domain Number 1 Region: 3-154
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 7.85e-38
Family SMI1/KNR4-like 0.00000932
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0H3IBS6
Sequence length 156
Comment (tr|A0A0H3IBS6|A0A0H3IBS6_PECSS) YobK {ECO:0000313|EMBL:AFI92494.1} KW=Complete proteome OX=1905730 OS=Pectobacterium sp. (strain SCC3193). GN=W5S_4448 OC=Pectobacteriaceae; Pectobacterium.
Sequence
MIDELFLKIEKIMADSEESHYGSGPASEEDIIKYESELGVLFPESYKFFLRKYGTLTFNG
ESFYGISKKGLSAISAPDVRYVTLETRKLGDIDNGMVQIKSSGCGPVFSIDTSMLGESGE
AVVVETALSFKRDHNKVVVAQSFADFLLHEIEESLI
Download sequence
Identical sequences A0A0H3IBS6 D0KCB2
gi|470156864|ref|YP_006285366.1| gi|261823501|ref|YP_003261607.1| 561231.Pecwa_4290 WP_014701874.1.14155 WP_014701874.1.78307

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]