SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0H3J5R5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0H3J5R5
Domain Number 1 Region: 1-156
Classification Level Classification E-value
Superfamily N5-CAIR mutase (phosphoribosylaminoimidazole carboxylase, PurE) 6.28e-59
Family N5-CAIR mutase (phosphoribosylaminoimidazole carboxylase, PurE) 0.0000067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0H3J5R5
Sequence length 159
Comment (tr|A0A0H3J5R5|A0A0H3J5R5_CLOPA) 5-(carboxyamino)imidazole ribonucleotide mutase {ECO:0000256|HAMAP-Rule:MF_01929} KW=Complete proteome; Reference proteome OX=1262449 OS=Clostridium pasteurianum DSM 525 = ATCC 6013. GN=CLPA_c24780 OC=Clostridium.
Sequence
MKVAIIFGSKSDVDKMKGAAKALKEFDIEYRVHILSAHRVPEKLSQVIQDLEAEDFDCII
AGAGLAAHLPGVIASHTTLPVIGVPINAALNGLDSLLSIVQMPKSIPVATVGINNSYNAG
MLAVQMLSLKYPDLKEKLIQYRKDMKSKFISENEEGVEL
Download sequence
Identical sequences A0A0H3J5R5 A0A1D9N4M1
WP_003447544.1.15649 WP_003447544.1.61834 WP_003447544.1.63412 WP_003447544.1.65006 WP_003447544.1.70023 WP_003447544.1.82391 WP_003447544.1.85023

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]