SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0H3MC71 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0H3MC71
Domain Number 1 Region: 81-298
Classification Level Classification E-value
Superfamily ARM repeat 2.61e-22
Family Armadillo repeat 0.052
Further Details:      
 
Weak hits

Sequence:  A0A0H3MC71
Domain Number - Region: 346-393
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 0.0203
Family Regulator of G-protein signaling, RGS 0.01
Further Details:      
 
Domain Number - Region: 403-473
Classification Level Classification E-value
Superfamily ARM repeat 0.042
Family Armadillo repeat 0.074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0H3MC71
Sequence length 566
Comment (tr|A0A0H3MC71|A0A0H3MC71_CHLT2) Putative lipoprotein {ECO:0000313|EMBL:CAP04045.1} KW=Complete proteome OX=471472 OS=Chlamydia trachomatis serovar L2 (strain 434/Bu / ATCC VR-902B). GN=CTL0604 OC=Chlamydia/Chlamydophila group; Chlamydia.
Sequence
MGLSRLAFIGFLSFTLSASCDFPSSVSQRILFSCQKSVPQALEAYLEASVTYQQHDFSVL
RVIAESYLQQSFLSEDTHIRKSAIIGAGLSGSSEALELLSEAIETQDLYEQLLILNAATS
QLSKTSDKLLFKGLTASHPVIRLEAAYRLACMKNSKVSDYLYSFIYKLPEEIQNLAATIF
LQLETEEADAYIHRLLSSPNNLTRNYVAYLIGEYKQKRFLPTLRSLLTSASPLDQEGALY
ALGKLEDSGSYPRIKALSSRSNPEVVLAAAQTLLFLEKEEEALPILTNLCQQKLLRALYT
ARFLSQEKGEELLLPIFYNATQEEIRLNTALALVHQGCTDPQVLHYLTEILESKVLHRIF
LPTHSTGKAIQFWKECTTFPLMSQEDKMRTLAMYRVAEDTILSALLKLPNDAYLPYLERI
LASQKTILAAKAIAFLSVTAHPQALSLVSKAALTPGDPIIRAYANLALYTMTKDPEKKAV
LYRYAEQLIEDTILFTDAENPLPSPSSSYLRYQVSPETRTQLMLAILETLVSSKTDEDIR
VFLSLMKKTHYKNIPILSGLLMRIVE
Download sequence
Identical sequences A0A0H3MC71
gi|482545713|ref|YP_007851631.1| WP_009873747.1.100883 WP_009873747.1.11148 WP_009873747.1.17082 WP_009873747.1.22210 WP_009873747.1.27980 WP_009873747.1.32801 WP_009873747.1.40808 WP_009873747.1.58046 WP_009873747.1.60427 WP_009873747.1.61004 WP_009873747.1.62489 WP_009873747.1.67104 WP_009873747.1.71307 WP_009873747.1.83642 WP_009873747.1.85365 WP_009873747.1.95142 WP_009873747.1.99598 YP_001654680.1.27483 gi|527321915|ref|YP_008348113.1| gi|478447181|ref|YP_007715869.1| gi|482546656|ref|YP_007852572.1| gi|527327725|ref|YP_008353916.1| 471472.CTL0604 gi|527326798|ref|YP_008352990.1| gi|527328650|ref|YP_008354840.1| gi|527324952|ref|YP_008351146.1| gi|527323818|ref|YP_008350014.1| gi|527325877|ref|YP_008352070.1| gi|339626020|ref|YP_004717499.1| gi|527318168|ref|YP_008344370.1| gi|166154562|ref|YP_001654680.1| gi|527319089|ref|YP_008345290.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]