SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0H3N258 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0H3N258
Domain Number 1 Region: 11-130
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 1.11e-25
Family SMI1/KNR4-like 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0H3N258
Sequence length 136
Comment (tr|A0A0H3N258|A0A0H3N258_STRS4) Uncharacterized protein {ECO:0000313|EMBL:CAZ55171.1} KW=Complete proteome OX=568814 OS=Streptococcus suis (strain BM407). GN=SSUBM407_0339 OC=Streptococcus.
Sequence
MSQLVDKIKVVQGLYSGSPASEQEVAVAESKLQLIFPAEYKDYLKEYGVISFYGTEWNGL
KGDTWTDVVATTLEARSLYENFPKEKFILEDLHFDDMLVLADSTGKVFLWHNGLEKEIHS
SIASYLEECVARKDTP
Download sequence
Identical sequences A0A0H3N258 A0A2K1T233 D5AG46
218494.SSU0350 568813.SSUSC84_0336 568814.SSUBM407_0339 gi|253754967|ref|YP_003028107.1| gi|386579328|ref|YP_006075733.1| WP_012774976.1.10007 WP_012774976.1.100280 WP_012774976.1.100404 WP_012774976.1.100701 WP_012774976.1.100908 WP_012774976.1.101097 WP_012774976.1.101179 WP_012774976.1.101295 WP_012774976.1.101621 WP_012774976.1.101658 WP_012774976.1.101706 WP_012774976.1.102038 WP_012774976.1.10265 WP_012774976.1.1035 WP_012774976.1.10700 WP_012774976.1.10896 WP_012774976.1.11017 WP_012774976.1.11330 WP_012774976.1.11548 WP_012774976.1.11662 WP_012774976.1.11869 WP_012774976.1.11874 WP_012774976.1.1200 WP_012774976.1.12022 WP_012774976.1.12228 WP_012774976.1.12288 WP_012774976.1.1244 WP_012774976.1.12606 WP_012774976.1.12803 WP_012774976.1.13095 WP_012774976.1.1324 WP_012774976.1.13380 WP_012774976.1.13633 WP_012774976.1.13861 WP_012774976.1.1405 WP_012774976.1.14202 WP_012774976.1.14210 WP_012774976.1.1424 WP_012774976.1.1434 WP_012774976.1.14359 WP_012774976.1.1495 WP_012774976.1.15112 WP_012774976.1.1537 WP_012774976.1.15393 WP_012774976.1.15545 WP_012774976.1.15756 WP_012774976.1.15813 WP_012774976.1.16193 WP_012774976.1.1629 WP_012774976.1.16498 WP_012774976.1.16643 WP_012774976.1.16683 WP_012774976.1.16773 WP_012774976.1.16829 WP_012774976.1.16881 WP_012774976.1.17264 WP_012774976.1.17670 WP_012774976.1.17749 WP_012774976.1.17814 WP_012774976.1.17958 WP_012774976.1.17989 WP_012774976.1.18271 WP_012774976.1.18341 WP_012774976.1.18403 WP_012774976.1.18563 WP_012774976.1.18711 WP_012774976.1.18850 WP_012774976.1.19352 WP_012774976.1.19378 WP_012774976.1.1953 WP_012774976.1.19865 WP_012774976.1.19898 WP_012774976.1.20400 WP_012774976.1.20518 WP_012774976.1.20584 WP_012774976.1.20756 WP_012774976.1.20944 WP_012774976.1.21347 WP_012774976.1.21457 WP_012774976.1.21903 WP_012774976.1.22785 WP_012774976.1.22882 WP_012774976.1.23089 WP_012774976.1.23273 WP_012774976.1.23317 WP_012774976.1.23358 WP_012774976.1.23682 WP_012774976.1.23965 WP_012774976.1.24150 WP_012774976.1.24175 WP_012774976.1.24187 WP_012774976.1.24431 WP_012774976.1.24858 WP_012774976.1.24883 WP_012774976.1.25245 WP_012774976.1.25280 WP_012774976.1.25381 WP_012774976.1.25396 WP_012774976.1.25617 WP_012774976.1.25711 WP_012774976.1.25824 WP_012774976.1.25950 WP_012774976.1.26009 WP_012774976.1.26302 WP_012774976.1.26368 WP_012774976.1.26620 WP_012774976.1.27108 WP_012774976.1.27225 WP_012774976.1.27227 WP_012774976.1.27381 WP_012774976.1.27476 WP_012774976.1.27695 WP_012774976.1.27754 WP_012774976.1.27760 WP_012774976.1.27767 WP_012774976.1.28000 WP_012774976.1.28033 WP_012774976.1.28244 WP_012774976.1.28467 WP_012774976.1.28645 WP_012774976.1.28796 WP_012774976.1.28805 WP_012774976.1.29141 WP_012774976.1.29610 WP_012774976.1.30079 WP_012774976.1.30241 WP_012774976.1.30414 WP_012774976.1.30785 WP_012774976.1.31597 WP_012774976.1.31730 WP_012774976.1.32259 WP_012774976.1.32466 WP_012774976.1.32630 WP_012774976.1.32947 WP_012774976.1.33330 WP_012774976.1.34321 WP_012774976.1.34425 WP_012774976.1.34527 WP_012774976.1.34652 WP_012774976.1.34738 WP_012774976.1.35430 WP_012774976.1.35551 WP_012774976.1.35675 WP_012774976.1.35725 WP_012774976.1.36136 WP_012774976.1.36251 WP_012774976.1.36341 WP_012774976.1.36611 WP_012774976.1.36766 WP_012774976.1.36945 WP_012774976.1.37126 WP_012774976.1.37237 WP_012774976.1.376 WP_012774976.1.37653 WP_012774976.1.37688 WP_012774976.1.37816 WP_012774976.1.37841 WP_012774976.1.37915 WP_012774976.1.38409 WP_012774976.1.38470 WP_012774976.1.39011 WP_012774976.1.39023 WP_012774976.1.39247 WP_012774976.1.39280 WP_012774976.1.39714 WP_012774976.1.3989 WP_012774976.1.40062 WP_012774976.1.40141 WP_012774976.1.40228 WP_012774976.1.40384 WP_012774976.1.40507 WP_012774976.1.40669 WP_012774976.1.4074 WP_012774976.1.40802 WP_012774976.1.41046 WP_012774976.1.41112 WP_012774976.1.41280 WP_012774976.1.41340 WP_012774976.1.41854 WP_012774976.1.42323 WP_012774976.1.42552 WP_012774976.1.42596 WP_012774976.1.42732 WP_012774976.1.4278 WP_012774976.1.42784 WP_012774976.1.42827 WP_012774976.1.42840 WP_012774976.1.4291 WP_012774976.1.43264 WP_012774976.1.43288 WP_012774976.1.43482 WP_012774976.1.43813 WP_012774976.1.43922 WP_012774976.1.43963 WP_012774976.1.43977 WP_012774976.1.44047 WP_012774976.1.44128 WP_012774976.1.44592 WP_012774976.1.44676 WP_012774976.1.44778 WP_012774976.1.45088 WP_012774976.1.45216 WP_012774976.1.45219 WP_012774976.1.45278 WP_012774976.1.45345 WP_012774976.1.45864 WP_012774976.1.45936 WP_012774976.1.467 WP_012774976.1.46880 WP_012774976.1.47315 WP_012774976.1.47375 WP_012774976.1.47434 WP_012774976.1.4748 WP_012774976.1.4757 WP_012774976.1.47643 WP_012774976.1.47745 WP_012774976.1.47894 WP_012774976.1.47900 WP_012774976.1.48167 WP_012774976.1.48217 WP_012774976.1.48397 WP_012774976.1.48603 WP_012774976.1.49093 WP_012774976.1.49099 WP_012774976.1.49206 WP_012774976.1.49255 WP_012774976.1.49368 WP_012774976.1.49413 WP_012774976.1.49509 WP_012774976.1.49782 WP_012774976.1.49968 WP_012774976.1.50047 WP_012774976.1.5021 WP_012774976.1.50437 WP_012774976.1.50538 WP_012774976.1.50551 WP_012774976.1.50675 WP_012774976.1.50751 WP_012774976.1.5079 WP_012774976.1.50798 WP_012774976.1.51263 WP_012774976.1.51386 WP_012774976.1.51551 WP_012774976.1.52159 WP_012774976.1.52175 WP_012774976.1.52599 WP_012774976.1.52628 WP_012774976.1.52798 WP_012774976.1.53174 WP_012774976.1.53290 WP_012774976.1.53309 WP_012774976.1.534 WP_012774976.1.53448 WP_012774976.1.53487 WP_012774976.1.53749 WP_012774976.1.53805 WP_012774976.1.54000 WP_012774976.1.5404 WP_012774976.1.54184 WP_012774976.1.54384 WP_012774976.1.54488 WP_012774976.1.54535 WP_012774976.1.54800 WP_012774976.1.54828 WP_012774976.1.55064 WP_012774976.1.55137 WP_012774976.1.55158 WP_012774976.1.55649 WP_012774976.1.55687 WP_012774976.1.5579 WP_012774976.1.55815 WP_012774976.1.55833 WP_012774976.1.55834 WP_012774976.1.56140 WP_012774976.1.56215 WP_012774976.1.56434 WP_012774976.1.56463 WP_012774976.1.57067 WP_012774976.1.5714 WP_012774976.1.57164 WP_012774976.1.5754 WP_012774976.1.57640 WP_012774976.1.57674 WP_012774976.1.57810 WP_012774976.1.58229 WP_012774976.1.58517 WP_012774976.1.58566 WP_012774976.1.58585 WP_012774976.1.58706 WP_012774976.1.58746 WP_012774976.1.58793 WP_012774976.1.58815 WP_012774976.1.58903 WP_012774976.1.59071 WP_012774976.1.59138 WP_012774976.1.59144 WP_012774976.1.59283 WP_012774976.1.59349 WP_012774976.1.5936 WP_012774976.1.59524 WP_012774976.1.59647 WP_012774976.1.5974 WP_012774976.1.60237 WP_012774976.1.60293 WP_012774976.1.60377 WP_012774976.1.60445 WP_012774976.1.60658 WP_012774976.1.60659 WP_012774976.1.60853 WP_012774976.1.609 WP_012774976.1.61370 WP_012774976.1.61533 WP_012774976.1.61540 WP_012774976.1.6156 WP_012774976.1.6165 WP_012774976.1.61782 WP_012774976.1.6223 WP_012774976.1.62268 WP_012774976.1.62485 WP_012774976.1.6278 WP_012774976.1.62805 WP_012774976.1.63318 WP_012774976.1.63653 WP_012774976.1.63959 WP_012774976.1.64128 WP_012774976.1.64273 WP_012774976.1.64281 WP_012774976.1.64384 WP_012774976.1.64641 WP_012774976.1.64797 WP_012774976.1.64952 WP_012774976.1.65024 WP_012774976.1.65047 WP_012774976.1.65174 WP_012774976.1.65314 WP_012774976.1.65422 WP_012774976.1.65458 WP_012774976.1.65905 WP_012774976.1.65911 WP_012774976.1.65917 WP_012774976.1.6596 WP_012774976.1.66185 WP_012774976.1.66472 WP_012774976.1.66590 WP_012774976.1.66609 WP_012774976.1.66707 WP_012774976.1.6686 WP_012774976.1.66954 WP_012774976.1.67058 WP_012774976.1.67109 WP_012774976.1.6711 WP_012774976.1.67256 WP_012774976.1.67338 WP_012774976.1.67488 WP_012774976.1.677 WP_012774976.1.67883 WP_012774976.1.67897 WP_012774976.1.67958 WP_012774976.1.67962 WP_012774976.1.68010 WP_012774976.1.68303 WP_012774976.1.68602 WP_012774976.1.68666 WP_012774976.1.68739 WP_012774976.1.68791 WP_012774976.1.68941 WP_012774976.1.69115 WP_012774976.1.69161 WP_012774976.1.69413 WP_012774976.1.69454 WP_012774976.1.69698 WP_012774976.1.69706 WP_012774976.1.69922 WP_012774976.1.70033 WP_012774976.1.70387 WP_012774976.1.70817 WP_012774976.1.70997 WP_012774976.1.71125 WP_012774976.1.71140 WP_012774976.1.71425 WP_012774976.1.71498 WP_012774976.1.71727 WP_012774976.1.72174 WP_012774976.1.72247 WP_012774976.1.72296 WP_012774976.1.72413 WP_012774976.1.7257 WP_012774976.1.73011 WP_012774976.1.73262 WP_012774976.1.73280 WP_012774976.1.73299 WP_012774976.1.73679 WP_012774976.1.73721 WP_012774976.1.73905 WP_012774976.1.74567 WP_012774976.1.74800 WP_012774976.1.74843 WP_012774976.1.74865 WP_012774976.1.75022 WP_012774976.1.75028 WP_012774976.1.75605 WP_012774976.1.75930 WP_012774976.1.75965 WP_012774976.1.75985 WP_012774976.1.76083 WP_012774976.1.76175 WP_012774976.1.76400 WP_012774976.1.76735 WP_012774976.1.76907 WP_012774976.1.77006 WP_012774976.1.77616 WP_012774976.1.77624 WP_012774976.1.77781 WP_012774976.1.77795 WP_012774976.1.77958 WP_012774976.1.78326 WP_012774976.1.78456 WP_012774976.1.7873 WP_012774976.1.78744 WP_012774976.1.78792 WP_012774976.1.7889 WP_012774976.1.78945 WP_012774976.1.79054 WP_012774976.1.79154 WP_012774976.1.79162 WP_012774976.1.79499 WP_012774976.1.79644 WP_012774976.1.79679 WP_012774976.1.80097 WP_012774976.1.80131 WP_012774976.1.80153 WP_012774976.1.80169 WP_012774976.1.80216 WP_012774976.1.80418 WP_012774976.1.8061 WP_012774976.1.80716 WP_012774976.1.80742 WP_012774976.1.81103 WP_012774976.1.81370 WP_012774976.1.81513 WP_012774976.1.81584 WP_012774976.1.81705 WP_012774976.1.82122 WP_012774976.1.8251 WP_012774976.1.82830 WP_012774976.1.82870 WP_012774976.1.82977 WP_012774976.1.83818 WP_012774976.1.83915 WP_012774976.1.84389 WP_012774976.1.8451 WP_012774976.1.85051 WP_012774976.1.85075 WP_012774976.1.85327 WP_012774976.1.85437 WP_012774976.1.85908 WP_012774976.1.86151 WP_012774976.1.86177 WP_012774976.1.86817 WP_012774976.1.86836 WP_012774976.1.86842 WP_012774976.1.87044 WP_012774976.1.87321 WP_012774976.1.87344 WP_012774976.1.87438 WP_012774976.1.87450 WP_012774976.1.87819 WP_012774976.1.87874 WP_012774976.1.87885 WP_012774976.1.8790 WP_012774976.1.88543 WP_012774976.1.88575 WP_012774976.1.88653 WP_012774976.1.88779 WP_012774976.1.89037 WP_012774976.1.89038 WP_012774976.1.89056 WP_012774976.1.89128 WP_012774976.1.89156 WP_012774976.1.89279 WP_012774976.1.89358 WP_012774976.1.89388 WP_012774976.1.89800 WP_012774976.1.8993 WP_012774976.1.89989 WP_012774976.1.90172 WP_012774976.1.90419 WP_012774976.1.90742 WP_012774976.1.90961 WP_012774976.1.91238 WP_012774976.1.91636 WP_012774976.1.91865 WP_012774976.1.91912 WP_012774976.1.91973 WP_012774976.1.91983 WP_012774976.1.92134 WP_012774976.1.92263 WP_012774976.1.92441 WP_012774976.1.92554 WP_012774976.1.92692 WP_012774976.1.92722 WP_012774976.1.928 WP_012774976.1.93190 WP_012774976.1.93456 WP_012774976.1.93519 WP_012774976.1.9361 WP_012774976.1.93627 WP_012774976.1.93646 WP_012774976.1.9376 WP_012774976.1.93771 WP_012774976.1.94332 WP_012774976.1.94338 WP_012774976.1.94418 WP_012774976.1.94419 WP_012774976.1.94449 WP_012774976.1.9454 WP_012774976.1.94639 WP_012774976.1.94786 WP_012774976.1.94945 WP_012774976.1.95180 WP_012774976.1.95213 WP_012774976.1.95214 WP_012774976.1.95262 WP_012774976.1.95288 WP_012774976.1.95542 WP_012774976.1.95798 WP_012774976.1.96164 WP_012774976.1.96282 WP_012774976.1.96451 WP_012774976.1.9652 WP_012774976.1.96524 WP_012774976.1.96574 WP_012774976.1.96700 WP_012774976.1.97052 WP_012774976.1.97453 WP_012774976.1.97493 WP_012774976.1.97504 WP_012774976.1.97554 WP_012774976.1.97857 WP_012774976.1.9809 WP_012774976.1.9815 WP_012774976.1.98253 WP_012774976.1.98271 WP_012774976.1.98326 WP_012774976.1.98343 WP_012774976.1.98416 WP_012774976.1.98860 WP_012774976.1.98864 WP_012774976.1.98921 WP_012774976.1.99127 WP_012774976.1.9922 WP_012774976.1.99252 WP_012774976.1.99324 WP_012774976.1.99696 WP_012774976.1.99988 YP_003028107.1.79686 gi|403061033|ref|YP_006649249.1| gi|253751243|ref|YP_003024384.1| gi|386587623|ref|YP_006084024.1| gi|386581392|ref|YP_006077796.1| gi|476419334|ref|YP_007570330.1| gi|386577348|ref|YP_006073753.1| gi|253753144|ref|YP_003026284.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]