SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0H3PDR2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0H3PDR2
Domain Number 1 Region: 2-178
Classification Level Classification E-value
Superfamily VC0467-like 5.23e-58
Family VC0467-like 0.00000167
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0H3PDR2
Sequence length 186
Comment (tr|A0A0H3PDR2|A0A0H3PDR2_HAEI3) UPF0301 protein CGSHi3655_01999 {ECO:0000256|HAMAP-Rule:MF_00758} KW=Complete proteome OX=375177 OS=Haemophilus influenzae (strain NTHi 3655). GN=CGSHi3655_01999 OC=Pasteurellaceae; Haemophilus.
Sequence
MMELQGKFLIAMPHLDDYFNRTVVFMCEHNEQGSMGLVINQPTDLSIAELYSKLNFMMKN
DRTFGNEMVVAGGPVHTERGFILHKNTLNAFQHTYKVTEELSMTTSADVVETLGSTFAPE
KYLVALGCSSWGAGQLEKEIRDNAWLVVSSNDQILFDMPYEDRYAAANQLLGIHPYNFAL
AQVGHS
Download sequence
Identical sequences A0A0D0IJ64 A0A0E1SRD6 A0A0H3PDR2
gi|386263502|ref|YP_005826995.1| WP_005656292.1.101347 WP_005656292.1.101989 WP_005656292.1.17173 WP_005656292.1.17428 WP_005656292.1.20018 WP_005656292.1.25413 WP_005656292.1.26077 WP_005656292.1.3733 WP_005656292.1.38951 WP_005656292.1.40038 WP_005656292.1.40040 WP_005656292.1.42729 WP_005656292.1.46862 WP_005656292.1.51509 WP_005656292.1.52701 WP_005656292.1.55069 WP_005656292.1.56181 WP_005656292.1.63263 WP_005656292.1.6349 WP_005656292.1.67509 WP_005656292.1.68713 WP_005656292.1.76422 WP_005656292.1.78014 WP_005656292.1.78836 WP_005656292.1.87894 WP_005656292.1.90586 WP_005656292.1.92138 WP_005656292.1.98200 gi|386265299|ref|YP_005828791.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]