SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0H3QU81 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A0H3QU81
Domain Number - Region: 30-136
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.000392
Family SMI1/KNR4-like 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0H3QU81
Sequence length 188
Comment (tr|A0A0H3QU81|A0A0H3QU81_PSEAI) Uncharacterized protein {ECO:0000313|EMBL:EMZ52772.1} KW=Complete proteome OX=1125697 OS=Pseudomonas aeruginosa str. Stone 130. GN=HMPREF1223_09911 OC=Pseudomonadaceae; Pseudomonas.
Sequence
MSPASASIRQRLLALGEPCAAQPAADWQGDIALPAELERFYREVGPLDCTLESAGNPFFL
PSLARLWQRQAGYRWHGISGERLSGWQDDWLVVADQGADPFILETGSGRILFDLHGGRGW
DPAPCFDDLWQMAASLVCFGEVWSGAGEDILLDDCSVAPRYRQQLVDELQPILGSRQRAE
DLADEFGW
Download sequence
Identical sequences A0A0H3QU81 A0A0Q1A9T8 A0A1E9BYK9 A0A1F0IW03
gi|392981781|ref|YP_006480368.1| WP_003117889.1.100071 WP_003117889.1.100420 WP_003117889.1.100523 WP_003117889.1.100654 WP_003117889.1.100742 WP_003117889.1.100786 WP_003117889.1.100808 WP_003117889.1.100810 WP_003117889.1.100872 WP_003117889.1.100983 WP_003117889.1.100995 WP_003117889.1.101090 WP_003117889.1.101506 WP_003117889.1.101572 WP_003117889.1.101712 WP_003117889.1.101863 WP_003117889.1.10457 WP_003117889.1.10468 WP_003117889.1.10477 WP_003117889.1.10482 WP_003117889.1.10572 WP_003117889.1.10636 WP_003117889.1.10641 WP_003117889.1.10901 WP_003117889.1.11026 WP_003117889.1.11058 WP_003117889.1.11077 WP_003117889.1.11381 WP_003117889.1.11568 WP_003117889.1.11653 WP_003117889.1.11744 WP_003117889.1.1180 WP_003117889.1.11847 WP_003117889.1.1187 WP_003117889.1.11943 WP_003117889.1.12018 WP_003117889.1.12120 WP_003117889.1.12482 WP_003117889.1.12530 WP_003117889.1.12797 WP_003117889.1.12873 WP_003117889.1.12970 WP_003117889.1.12980 WP_003117889.1.13 WP_003117889.1.1305 WP_003117889.1.13057 WP_003117889.1.13232 WP_003117889.1.13407 WP_003117889.1.1356 WP_003117889.1.1362 WP_003117889.1.13622 WP_003117889.1.13765 WP_003117889.1.13785 WP_003117889.1.13828 WP_003117889.1.14078 WP_003117889.1.14096 WP_003117889.1.14460 WP_003117889.1.14714 WP_003117889.1.1475 WP_003117889.1.14754 WP_003117889.1.14820 WP_003117889.1.152 WP_003117889.1.15379 WP_003117889.1.15474 WP_003117889.1.15480 WP_003117889.1.15485 WP_003117889.1.15692 WP_003117889.1.16041 WP_003117889.1.16109 WP_003117889.1.16142 WP_003117889.1.16197 WP_003117889.1.16267 WP_003117889.1.1670 WP_003117889.1.1671 WP_003117889.1.16782 WP_003117889.1.16808 WP_003117889.1.16895 WP_003117889.1.17022 WP_003117889.1.17162 WP_003117889.1.17354 WP_003117889.1.1739 WP_003117889.1.17566 WP_003117889.1.17697 WP_003117889.1.17890 WP_003117889.1.18052 WP_003117889.1.18199 WP_003117889.1.18204 WP_003117889.1.18234 WP_003117889.1.1824 WP_003117889.1.18493 WP_003117889.1.18547 WP_003117889.1.18728 WP_003117889.1.18769 WP_003117889.1.190 WP_003117889.1.19260 WP_003117889.1.19591 WP_003117889.1.19703 WP_003117889.1.1971 WP_003117889.1.19771 WP_003117889.1.20024 WP_003117889.1.20070 WP_003117889.1.20744 WP_003117889.1.20764 WP_003117889.1.20884 WP_003117889.1.209 WP_003117889.1.21242 WP_003117889.1.21349 WP_003117889.1.21448 WP_003117889.1.21469 WP_003117889.1.21517 WP_003117889.1.21607 WP_003117889.1.21718 WP_003117889.1.2172 WP_003117889.1.21767 WP_003117889.1.21782 WP_003117889.1.21932 WP_003117889.1.22078 WP_003117889.1.2228 WP_003117889.1.22394 WP_003117889.1.22704 WP_003117889.1.22729 WP_003117889.1.22863 WP_003117889.1.2289 WP_003117889.1.22891 WP_003117889.1.23195 WP_003117889.1.2323 WP_003117889.1.23418 WP_003117889.1.23523 WP_003117889.1.23525 WP_003117889.1.23559 WP_003117889.1.23581 WP_003117889.1.23611 WP_003117889.1.23641 WP_003117889.1.23715 WP_003117889.1.23884 WP_003117889.1.23925 WP_003117889.1.23961 WP_003117889.1.23983 WP_003117889.1.24066 WP_003117889.1.24101 WP_003117889.1.24351 WP_003117889.1.24662 WP_003117889.1.2477 WP_003117889.1.24862 WP_003117889.1.25075 WP_003117889.1.251 WP_003117889.1.25142 WP_003117889.1.25149 WP_003117889.1.25179 WP_003117889.1.25191 WP_003117889.1.25271 WP_003117889.1.2529 WP_003117889.1.25348 WP_003117889.1.25477 WP_003117889.1.25532 WP_003117889.1.2572 WP_003117889.1.25964 WP_003117889.1.26042 WP_003117889.1.261 WP_003117889.1.26301 WP_003117889.1.26334 WP_003117889.1.26463 WP_003117889.1.2652 WP_003117889.1.26539 WP_003117889.1.26604 WP_003117889.1.26841 WP_003117889.1.26906 WP_003117889.1.2698 WP_003117889.1.27018 WP_003117889.1.27505 WP_003117889.1.27534 WP_003117889.1.27587 WP_003117889.1.27738 WP_003117889.1.27837 WP_003117889.1.27858 WP_003117889.1.27966 WP_003117889.1.28006 WP_003117889.1.28258 WP_003117889.1.28316 WP_003117889.1.28372 WP_003117889.1.28383 WP_003117889.1.28468 WP_003117889.1.28528 WP_003117889.1.28602 WP_003117889.1.28623 WP_003117889.1.28823 WP_003117889.1.28838 WP_003117889.1.28849 WP_003117889.1.29062 WP_003117889.1.29096 WP_003117889.1.29179 WP_003117889.1.29208 WP_003117889.1.29481 WP_003117889.1.29498 WP_003117889.1.2961 WP_003117889.1.29753 WP_003117889.1.30120 WP_003117889.1.30475 WP_003117889.1.30567 WP_003117889.1.30707 WP_003117889.1.3072 WP_003117889.1.30886 WP_003117889.1.31076 WP_003117889.1.31087 WP_003117889.1.31105 WP_003117889.1.31138 WP_003117889.1.31147 WP_003117889.1.31279 WP_003117889.1.31501 WP_003117889.1.31741 WP_003117889.1.3179 WP_003117889.1.31852 WP_003117889.1.3189 WP_003117889.1.32134 WP_003117889.1.32137 WP_003117889.1.32544 WP_003117889.1.32711 WP_003117889.1.33133 WP_003117889.1.33152 WP_003117889.1.33186 WP_003117889.1.33204 WP_003117889.1.33210 WP_003117889.1.33216 WP_003117889.1.33387 WP_003117889.1.33455 WP_003117889.1.33658 WP_003117889.1.33733 WP_003117889.1.33734 WP_003117889.1.33822 WP_003117889.1.34000 WP_003117889.1.34039 WP_003117889.1.34136 WP_003117889.1.34151 WP_003117889.1.34191 WP_003117889.1.34317 WP_003117889.1.34402 WP_003117889.1.34472 WP_003117889.1.34689 WP_003117889.1.34784 WP_003117889.1.34821 WP_003117889.1.34832 WP_003117889.1.34836 WP_003117889.1.35036 WP_003117889.1.35231 WP_003117889.1.35431 WP_003117889.1.35573 WP_003117889.1.35639 WP_003117889.1.35669 WP_003117889.1.35679 WP_003117889.1.35682 WP_003117889.1.3576 WP_003117889.1.35768 WP_003117889.1.35843 WP_003117889.1.35857 WP_003117889.1.35872 WP_003117889.1.36170 WP_003117889.1.36521 WP_003117889.1.36587 WP_003117889.1.36879 WP_003117889.1.37125 WP_003117889.1.37163 WP_003117889.1.3721 WP_003117889.1.37216 WP_003117889.1.37366 WP_003117889.1.37500 WP_003117889.1.3781 WP_003117889.1.37814 WP_003117889.1.37818 WP_003117889.1.37826 WP_003117889.1.37842 WP_003117889.1.38146 WP_003117889.1.38151 WP_003117889.1.38186 WP_003117889.1.3821 WP_003117889.1.3833 WP_003117889.1.38583 WP_003117889.1.38657 WP_003117889.1.38661 WP_003117889.1.38706 WP_003117889.1.38889 WP_003117889.1.38971 WP_003117889.1.39046 WP_003117889.1.39088 WP_003117889.1.39122 WP_003117889.1.39186 WP_003117889.1.39271 WP_003117889.1.3943 WP_003117889.1.39444 WP_003117889.1.39452 WP_003117889.1.39786 WP_003117889.1.39989 WP_003117889.1.40135 WP_003117889.1.40207 WP_003117889.1.40213 WP_003117889.1.40243 WP_003117889.1.40419 WP_003117889.1.40512 WP_003117889.1.40994 WP_003117889.1.41301 WP_003117889.1.41502 WP_003117889.1.41692 WP_003117889.1.41732 WP_003117889.1.41832 WP_003117889.1.41846 WP_003117889.1.41888 WP_003117889.1.4190 WP_003117889.1.42146 WP_003117889.1.42294 WP_003117889.1.42423 WP_003117889.1.42643 WP_003117889.1.42778 WP_003117889.1.42789 WP_003117889.1.42973 WP_003117889.1.43107 WP_003117889.1.43293 WP_003117889.1.4348 WP_003117889.1.43593 WP_003117889.1.43662 WP_003117889.1.43783 WP_003117889.1.43802 WP_003117889.1.43826 WP_003117889.1.44094 WP_003117889.1.44260 WP_003117889.1.44581 WP_003117889.1.44760 WP_003117889.1.45090 WP_003117889.1.45146 WP_003117889.1.45202 WP_003117889.1.4522 WP_003117889.1.45328 WP_003117889.1.45464 WP_003117889.1.45478 WP_003117889.1.45485 WP_003117889.1.45818 WP_003117889.1.45934 WP_003117889.1.46032 WP_003117889.1.46093 WP_003117889.1.461 WP_003117889.1.46152 WP_003117889.1.46436 WP_003117889.1.46502 WP_003117889.1.46755 WP_003117889.1.46826 WP_003117889.1.46866 WP_003117889.1.46926 WP_003117889.1.47101 WP_003117889.1.47155 WP_003117889.1.47296 WP_003117889.1.47645 WP_003117889.1.47774 WP_003117889.1.47970 WP_003117889.1.48001 WP_003117889.1.48086 WP_003117889.1.48094 WP_003117889.1.48141 WP_003117889.1.48172 WP_003117889.1.48378 WP_003117889.1.48820 WP_003117889.1.48842 WP_003117889.1.49135 WP_003117889.1.49265 WP_003117889.1.49286 WP_003117889.1.49416 WP_003117889.1.49500 WP_003117889.1.49566 WP_003117889.1.49688 WP_003117889.1.49798 WP_003117889.1.49998 WP_003117889.1.50176 WP_003117889.1.50222 WP_003117889.1.5043 WP_003117889.1.50567 WP_003117889.1.50668 WP_003117889.1.50734 WP_003117889.1.50967 WP_003117889.1.50989 WP_003117889.1.51019 WP_003117889.1.51141 WP_003117889.1.5132 WP_003117889.1.51457 WP_003117889.1.51538 WP_003117889.1.51682 WP_003117889.1.51807 WP_003117889.1.51943 WP_003117889.1.51976 WP_003117889.1.52220 WP_003117889.1.5226 WP_003117889.1.52326 WP_003117889.1.52334 WP_003117889.1.52355 WP_003117889.1.52537 WP_003117889.1.5258 WP_003117889.1.52583 WP_003117889.1.52690 WP_003117889.1.52700 WP_003117889.1.52784 WP_003117889.1.53070 WP_003117889.1.53287 WP_003117889.1.53351 WP_003117889.1.53530 WP_003117889.1.53726 WP_003117889.1.53932 WP_003117889.1.53948 WP_003117889.1.54090 WP_003117889.1.54146 WP_003117889.1.54497 WP_003117889.1.54809 WP_003117889.1.54974 WP_003117889.1.55089 WP_003117889.1.55169 WP_003117889.1.56196 WP_003117889.1.56229 WP_003117889.1.56315 WP_003117889.1.56474 WP_003117889.1.56475 WP_003117889.1.56623 WP_003117889.1.56797 WP_003117889.1.56819 WP_003117889.1.56837 WP_003117889.1.56973 WP_003117889.1.57113 WP_003117889.1.57276 WP_003117889.1.58019 WP_003117889.1.58183 WP_003117889.1.58193 WP_003117889.1.58228 WP_003117889.1.58482 WP_003117889.1.59013 WP_003117889.1.59076 WP_003117889.1.59099 WP_003117889.1.59176 WP_003117889.1.59250 WP_003117889.1.59688 WP_003117889.1.59724 WP_003117889.1.59759 WP_003117889.1.60051 WP_003117889.1.60206 WP_003117889.1.60261 WP_003117889.1.60415 WP_003117889.1.60602 WP_003117889.1.60603 WP_003117889.1.60639 WP_003117889.1.60686 WP_003117889.1.60916 WP_003117889.1.60979 WP_003117889.1.61130 WP_003117889.1.61209 WP_003117889.1.61222 WP_003117889.1.6130 WP_003117889.1.61598 WP_003117889.1.61696 WP_003117889.1.6173 WP_003117889.1.61943 WP_003117889.1.62035 WP_003117889.1.62410 WP_003117889.1.62483 WP_003117889.1.62516 WP_003117889.1.62534 WP_003117889.1.62635 WP_003117889.1.62701 WP_003117889.1.62768 WP_003117889.1.6280 WP_003117889.1.6283 WP_003117889.1.62873 WP_003117889.1.62917 WP_003117889.1.63041 WP_003117889.1.63057 WP_003117889.1.63124 WP_003117889.1.63193 WP_003117889.1.63196 WP_003117889.1.63597 WP_003117889.1.63995 WP_003117889.1.64329 WP_003117889.1.64726 WP_003117889.1.64748 WP_003117889.1.64799 WP_003117889.1.64807 WP_003117889.1.64854 WP_003117889.1.64862 WP_003117889.1.64885 WP_003117889.1.64984 WP_003117889.1.65092 WP_003117889.1.65099 WP_003117889.1.65145 WP_003117889.1.65196 WP_003117889.1.65285 WP_003117889.1.65304 WP_003117889.1.65334 WP_003117889.1.65642 WP_003117889.1.65740 WP_003117889.1.65819 WP_003117889.1.6589 WP_003117889.1.65926 WP_003117889.1.66526 WP_003117889.1.66721 WP_003117889.1.66929 WP_003117889.1.66931 WP_003117889.1.66945 WP_003117889.1.66950 WP_003117889.1.67188 WP_003117889.1.67205 WP_003117889.1.67261 WP_003117889.1.67370 WP_003117889.1.67388 WP_003117889.1.67472 WP_003117889.1.67526 WP_003117889.1.67545 WP_003117889.1.67686 WP_003117889.1.67755 WP_003117889.1.67830 WP_003117889.1.67948 WP_003117889.1.68252 WP_003117889.1.6850 WP_003117889.1.68756 WP_003117889.1.68800 WP_003117889.1.68850 WP_003117889.1.68862 WP_003117889.1.68938 WP_003117889.1.69159 WP_003117889.1.69260 WP_003117889.1.69534 WP_003117889.1.69702 WP_003117889.1.69788 WP_003117889.1.69819 WP_003117889.1.69993 WP_003117889.1.70092 WP_003117889.1.70194 WP_003117889.1.70229 WP_003117889.1.70470 WP_003117889.1.70561 WP_003117889.1.7077 WP_003117889.1.70778 WP_003117889.1.71038 WP_003117889.1.7128 WP_003117889.1.71642 WP_003117889.1.71799 WP_003117889.1.71806 WP_003117889.1.72149 WP_003117889.1.72167 WP_003117889.1.72181 WP_003117889.1.72287 WP_003117889.1.72331 WP_003117889.1.72346 WP_003117889.1.72541 WP_003117889.1.72653 WP_003117889.1.7276 WP_003117889.1.72772 WP_003117889.1.73048 WP_003117889.1.73135 WP_003117889.1.73149 WP_003117889.1.7327 WP_003117889.1.733 WP_003117889.1.73523 WP_003117889.1.73601 WP_003117889.1.7382 WP_003117889.1.73911 WP_003117889.1.73941 WP_003117889.1.74219 WP_003117889.1.74458 WP_003117889.1.74473 WP_003117889.1.74568 WP_003117889.1.74604 WP_003117889.1.748 WP_003117889.1.74948 WP_003117889.1.75204 WP_003117889.1.7547 WP_003117889.1.75549 WP_003117889.1.75573 WP_003117889.1.75599 WP_003117889.1.75631 WP_003117889.1.75771 WP_003117889.1.7595 WP_003117889.1.76145 WP_003117889.1.76355 WP_003117889.1.76399 WP_003117889.1.76441 WP_003117889.1.76543 WP_003117889.1.76600 WP_003117889.1.76716 WP_003117889.1.77235 WP_003117889.1.77317 WP_003117889.1.7779 WP_003117889.1.78280 WP_003117889.1.78380 WP_003117889.1.78409 WP_003117889.1.78430 WP_003117889.1.78437 WP_003117889.1.78570 WP_003117889.1.78810 WP_003117889.1.78954 WP_003117889.1.79177 WP_003117889.1.79311 WP_003117889.1.79429 WP_003117889.1.7945 WP_003117889.1.79463 WP_003117889.1.79507 WP_003117889.1.7953 WP_003117889.1.79569 WP_003117889.1.79631 WP_003117889.1.79788 WP_003117889.1.79986 WP_003117889.1.80306 WP_003117889.1.80410 WP_003117889.1.80411 WP_003117889.1.80481 WP_003117889.1.8051 WP_003117889.1.8064 WP_003117889.1.80720 WP_003117889.1.80846 WP_003117889.1.80938 WP_003117889.1.81206 WP_003117889.1.81482 WP_003117889.1.81581 WP_003117889.1.81622 WP_003117889.1.81742 WP_003117889.1.81784 WP_003117889.1.81844 WP_003117889.1.81950 WP_003117889.1.82127 WP_003117889.1.82312 WP_003117889.1.82334 WP_003117889.1.82710 WP_003117889.1.82864 WP_003117889.1.82882 WP_003117889.1.82936 WP_003117889.1.83184 WP_003117889.1.83251 WP_003117889.1.83296 WP_003117889.1.83394 WP_003117889.1.835 WP_003117889.1.83534 WP_003117889.1.83946 WP_003117889.1.84008 WP_003117889.1.84190 WP_003117889.1.84203 WP_003117889.1.84271 WP_003117889.1.84297 WP_003117889.1.84374 WP_003117889.1.8453 WP_003117889.1.84538 WP_003117889.1.84589 WP_003117889.1.84754 WP_003117889.1.84792 WP_003117889.1.85018 WP_003117889.1.85028 WP_003117889.1.85059 WP_003117889.1.85220 WP_003117889.1.85290 WP_003117889.1.85318 WP_003117889.1.85633 WP_003117889.1.85897 WP_003117889.1.86058 WP_003117889.1.86125 WP_003117889.1.86278 WP_003117889.1.86293 WP_003117889.1.86545 WP_003117889.1.86552 WP_003117889.1.867 WP_003117889.1.86708 WP_003117889.1.86733 WP_003117889.1.86985 WP_003117889.1.8718 WP_003117889.1.87390 WP_003117889.1.87435 WP_003117889.1.8749 WP_003117889.1.87530 WP_003117889.1.87648 WP_003117889.1.88004 WP_003117889.1.88308 WP_003117889.1.88517 WP_003117889.1.88659 WP_003117889.1.88750 WP_003117889.1.88949 WP_003117889.1.89234 WP_003117889.1.89276 WP_003117889.1.89409 WP_003117889.1.8949 WP_003117889.1.89491 WP_003117889.1.89577 WP_003117889.1.89610 WP_003117889.1.89662 WP_003117889.1.89669 WP_003117889.1.89736 WP_003117889.1.89805 WP_003117889.1.89866 WP_003117889.1.89886 WP_003117889.1.90024 WP_003117889.1.90056 WP_003117889.1.90150 WP_003117889.1.90225 WP_003117889.1.90242 WP_003117889.1.90306 WP_003117889.1.90412 WP_003117889.1.9056 WP_003117889.1.90569 WP_003117889.1.91161 WP_003117889.1.9120 WP_003117889.1.91416 WP_003117889.1.9143 WP_003117889.1.91431 WP_003117889.1.91438 WP_003117889.1.9182 WP_003117889.1.91860 WP_003117889.1.91862 WP_003117889.1.92314 WP_003117889.1.92321 WP_003117889.1.92357 WP_003117889.1.92573 WP_003117889.1.92585 WP_003117889.1.92589 WP_003117889.1.92624 WP_003117889.1.92769 WP_003117889.1.92839 WP_003117889.1.92847 WP_003117889.1.92924 WP_003117889.1.92930 WP_003117889.1.93250 WP_003117889.1.9328 WP_003117889.1.9349 WP_003117889.1.93493 WP_003117889.1.93848 WP_003117889.1.93897 WP_003117889.1.94004 WP_003117889.1.94031 WP_003117889.1.94218 WP_003117889.1.94285 WP_003117889.1.94682 WP_003117889.1.94874 WP_003117889.1.94896 WP_003117889.1.95025 WP_003117889.1.95027 WP_003117889.1.95117 WP_003117889.1.95187 WP_003117889.1.95207 WP_003117889.1.95305 WP_003117889.1.95324 WP_003117889.1.95460 WP_003117889.1.95488 WP_003117889.1.95525 WP_003117889.1.95536 WP_003117889.1.95820 WP_003117889.1.95825 WP_003117889.1.9599 WP_003117889.1.96041 WP_003117889.1.96243 WP_003117889.1.96267 WP_003117889.1.96357 WP_003117889.1.96434 WP_003117889.1.96667 WP_003117889.1.96702 WP_003117889.1.96880 WP_003117889.1.96967 WP_003117889.1.9706 WP_003117889.1.97118 WP_003117889.1.97126 WP_003117889.1.97213 WP_003117889.1.9722 WP_003117889.1.97474 WP_003117889.1.97614 WP_003117889.1.97968 WP_003117889.1.98308 WP_003117889.1.98410 WP_003117889.1.98414 WP_003117889.1.98433 WP_003117889.1.98522 WP_003117889.1.98573 WP_003117889.1.98610 WP_003117889.1.98788 WP_003117889.1.99103 WP_003117889.1.99214 WP_003117889.1.99293 WP_003117889.1.99353 WP_003117889.1.99461 WP_003117889.1.99654 WP_003117889.1.99662 WP_003117889.1.99746 WP_003117889.1.99757 WP_003117889.1.99795 WP_003117889.1.99835 WP_003117889.1.99930 gi|568151550|ref|YP_008940497.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]