SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0H3R1V9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0H3R1V9
Domain Number 1 Region: 14-118
Classification Level Classification E-value
Superfamily PapD-like 1.67e-22
Family Pilus chaperone 0.0033
Further Details:      
 
Domain Number 2 Region: 126-213
Classification Level Classification E-value
Superfamily Periplasmic chaperone C-domain 0.00000000000000615
Family Periplasmic chaperone C-domain 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0H3R1V9
Sequence length 222
Comment (tr|A0A0H3R1V9|A0A0H3R1V9_PSEAI) Uncharacterized protein {ECO:0000313|EMBL:EMZ54537.1} KW=Complete proteome OX=1125697 OS=Pseudomonas aeruginosa str. Stone 130. GN=HMPREF1223_09778 OC=Pseudomonadaceae; Pseudomonas.
Sequence
MSAHADLSFDGQNRFVMKGKRLPITLVNEGKEPALAEISLDWGTDGKGQALPFAVSRPLL
RLGAGQRAKVEVLYQGQGLPTDRETYLLLSVLDVPHAPSTPETLQIALRHRFKLFYRPPL
EATVEQANEGVTWTLGTSGNPKAHNPSPYHITFSQLEFLDASERSCGEAIEHLMLAPFSN
HQFDIAACHPDKVRYAIVSDGGNLHPYHGALKSGVETNAKHP
Download sequence
Identical sequences A0A0D6FMX9 A0A0H3R1V9
gi|392981910|ref|YP_006480497.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]