SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0H3STI5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0H3STI5
Domain Number 1 Region: 2-108
Classification Level Classification E-value
Superfamily BH3703-like 0.000000000602
Family BH3703-like 0.0069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0H3STI5
Sequence length 151
Comment (tr|A0A0H3STI5|A0A0H3STI5_9GAMM) Uncharacterized protein {ECO:0000313|EMBL:KJG55394.1} KW=Complete proteome OX=318456 OS=Photobacterium kishitanii. GN=UA38_19870 OC=Vibrionaceae; Photobacterium.
Sequence
METFEDIYQHIGQAMFNALPDEWDSAYFYISIKRIYPRACEYKESYFLKGVESDFSVDEN
DGDYGCTDTFFELYDLMQKDDSDVPWNKARFELKPDGSFDIQSKYDEDFAWLKSLNLRRK
KIMIFMKVLILILSTRLKLGMVYQKILTAIG
Download sequence
Identical sequences A0A0H3STI5
WP_045044114.1.65751 WP_045044114.1.67757 WP_045044114.1.75476 WP_045044114.1.95439

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]