SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0H3TLQ5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A0H3TLQ5
Domain Number - Region: 129-186
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.000981
Family Pseudo ankyrin repeat 0.024
Further Details:      
 
Domain Number - Region: 118-140
Classification Level Classification E-value
Superfamily Zn-finger domain of Sec23/24 0.0549
Family Zn-finger domain of Sec23/24 0.0097
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0H3TLQ5
Sequence length 242
Comment (tr|A0A0H3TLQ5|A0A0H3TLQ5_9VIRU) Uncharacterized protein {ECO:0000313|EMBL:AIB51921.1} OX=1477405 OS=Faustovirus. GN=D5a_00222 OC=Viruses; unclassified viruses.
Sequence
MDPFGLLPIEILDIILEFIENTSIKQNDKELLFDTYDILLGVSKSTRTTIGVPFLKRIYK
LCGDDSFIFMNYVIKFGESRISNFINSTRGSGIINLNYDKHITDAPFKTGMFFGMLHVDP
YTVIDQNTFIFACRLCYMSRINNYANIEFIKNLHDKVFKINYNCLLEAAVYSDSPNVILF
MIDEGYIGINYAKEYIMRRDNAFCLSMLIKANEFIVSYEDIGNAIYMNAIKCKDILQLEM
ND
Download sequence
Identical sequences A0A0H3TLQ5
gi|655871774|ref|YP_009041695.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]