SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0H3WK36 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0H3WK36
Domain Number 1 Region: 81-113
Classification Level Classification E-value
Superfamily Homing endonucleases 0.000034
Family Intein endonuclease 0.098
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0H3WK36
Sequence length 113
Comment (tr|A0A0H3WK36|A0A0H3WK36_SACPA) Uncharacterized protein {ECO:0000313|EMBL:AKL82816.1} OX=27291 OS=Saccharomyces paradoxus (Yeast) (Saccharomyces douglasii). GN=orf113 OC=Saccharomycetes; Saccharomycetales; Saccharomycetaceae; Saccharomyces.
Sequence
MYNTSTWKTNTNLIGFTNTNNMKMLPIINNFIFISTGARTHYGSRNPVRRNMHMDNKSLI
MANNKLYNNTLLNKIKDTTFMSMKHFKNWLLGFVVGDGYFGIKKNMTHSFNIT
Download sequence
Identical sequences A0A0H3WK36

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]