SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0H3WLJ1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0H3WLJ1
Domain Number 1 Region: 5-104
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.00000000916
Family SMI1/KNR4-like 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0H3WLJ1
Sequence length 110
Comment (tr|A0A0H3WLJ1|A0A0H3WLJ1_NEIME) Putative immunity protein MafI {ECO:0000313|EMBL:AKM12322.1} OX=487 OS=Neisseria meningitidis. GN= OC=Neisseriaceae; Neisseria.
Sequence
MLPKGFKYPQSYLKLAQSTHAINYDEQYSFPWWFENAESNISEVIDIYFEITGIPNLLPF
ARNQEWAACFDISDKSGNPKIIVVNLDNTKYYETFENFDTWLKEAENDGW
Download sequence
Identical sequences A0A0H3WLJ1 A1KWI4
WP_011799042.1.17756 WP_011799042.1.51703 WP_011799042.1.78092 WP_011799042.1.84443 272831.NMC2089 gi|121635763|ref|YP_976008.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]